Clone MIP16655 Report

Search the DGRC for MIP16655

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:166
Well:55
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG32832-RA
Protein status:MIP16655.pep: gold
Sequenced Size:695

Clone Sequence Records

MIP16655.complete Sequence

695 bp assembled on 2010-01-27

GenBank Submission: BT120221.1

> MIP16655.complete
CCTTGGTTATCACTTCAAAATTCTTTTCTTTTTTCCTGGAACTTTGGCTT
TTAAATTTTTAGTTTTTCTTAAAAATGTCTAAAGGCACGGGACCCTTGTC
TAAGTTGTACAATATTACCATCAGTACTATTGATAAATTTGTTCCAGGCG
CAGTTCAGCCACTTTGGCAATCCCCAGCTGGACCCCGTACTGTGTTTTTT
TGGGCACCAGCGTTTAAATGGTCCTTGGTGCTGGCTGGGCTGAGCGATAC
GCTAAGTCGTCCTCCTGCCAATATATCGCTGAATCAATGCGGCTCCTTGG
CAGTCACGGGCTTAATTTGGTCTCGCTACTCAGTGGTTATCACACCCAAG
AACTACAATCTTCTGGCCGTCAACATAGCCGTCTTTCTCATCCAGGGTTA
TCTAATGGTCAAGCACCTAAGGTGGCGCAGCGAGAACTCTCGGAATGCGG
TGTTCAATCATTCGCACTACCCAATCAAATCAGGAGATGATTGGTAGCAA
GAAAATCAATTTATTGAAAGTTGGCGTTATTTGAAATCATCTGAACTTAA
AGTCGCATTAACCGAAAGTTAAAGTCGTTATAGACTGAAAAACGGCTGTT
TAGTTAATCAAAAAAGATATTACAATCTATAAAGACAGTTCTGTGCCAAT
AAATGCTTACCATATTGAATTACTCAAAAAAAAAAAAAAAAAAAA

MIP16655.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG32832.b 724 CG32832.b 40..716 1..677 3385 100 Plus
CG32832.a 345 CG32832.a 28..345 180..497 1590 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16877084..16877538 675..221 2275 100 Minus
chr2L 23010047 chr2L 16877771..16877951 181..1 905 100 Minus
chr2L 23010047 chr2L 16877678..16877719 221..180 210 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16878421..16878877 677..221 2285 100 Minus
2L 23513712 2L 16879110..16879290 181..1 905 100 Minus
2L 23513712 2L 16879017..16879058 221..180 210 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16878421..16878877 677..221 2285 100 Minus
2L 23513712 2L 16879110..16879290 181..1 905 100 Minus
2L 23513712 2L 16879017..16879058 221..180 210 100 Minus
Blast to na_te.dros performed 2019-03-16 18:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 4987..5121 665..531 124 60.4 Minus

MIP16655.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:16:55 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16877678..16877718 181..221 100 <- Minus
chr2L 16877772..16877951 1..180 100   Minus
chr2L 16877084..16877537 222..675 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-27 19:48:53 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
CG32832-RA 1..423 75..497 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:12:41 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
CG32832-RA 1..423 75..497 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:17:47 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
CG32832-RA 1..423 75..497 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:36:08 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
CG32832-RA 1..423 75..497 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-27 19:48:53 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
CG32832-RA 1..482 16..497 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:12:41 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
CG32832-RA 1..482 16..497 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:17:47 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
CG32832-RA 1..675 1..675 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:36:08 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
CG32832-RA 1..675 1..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:16:55 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16878423..16878876 222..675 100 <- Minus
2L 16879017..16879057 181..221 100 <- Minus
2L 16879111..16879290 1..180 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:16:55 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16878423..16878876 222..675 100 <- Minus
2L 16879017..16879057 181..221 100 <- Minus
2L 16879111..16879290 1..180 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:16:55 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16878423..16878876 222..675 100 <- Minus
2L 16879017..16879057 181..221 100 <- Minus
2L 16879111..16879290 1..180 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:17:47 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16878423..16878876 222..675 100 <- Minus
arm_2L 16879017..16879057 181..221 100 <- Minus
arm_2L 16879111..16879290 1..180 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:33 Download gff for MIP16655.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16878423..16878876 222..675 100 <- Minus
2L 16879017..16879057 181..221 100 <- Minus
2L 16879111..16879290 1..180 100   Minus

MIP16655.hyp Sequence

Translation from 74 to 496

> MIP16655.hyp
MSKGTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWS
LVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVN
IAVFLIQGYLMVKHLRWRSENSRNAVFNHSHYPIKSGDDW*

MIP16655.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG32832-PB 140 CG32832-PB 1..140 1..140 747 100 Plus
CG32832-PA 140 CG32832-PA 1..140 1..140 747 100 Plus
CG9399-PD 154 CG9399-PD 22..126 2..107 338 61.3 Plus
CG9399-PA 154 CG9399-PA 22..126 2..107 338 61.3 Plus
CG9399-PB 154 CG9399-PB 22..126 2..107 338 61.3 Plus

MIP16655.pep Sequence

Translation from 74 to 496

> MIP16655.pep
MSKGTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWS
LVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVN
IAVFLIQGYLMVKHLRWRSENSRNAVFNHSHYPIKSGDDW*

MIP16655.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14537-PA 140 GF14537-PA 1..139 1..139 518 68.3 Plus
Dana\GF16532-PA 156 GF16532-PA 26..144 4..123 339 54.2 Plus
Dana\GF16533-PA 150 GF16533-PA 15..135 2..123 315 52.5 Plus
Dana\GF15117-PA 143 GF15117-PA 3..114 7..123 286 49.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21765-PA 140 GG21765-PA 1..140 1..140 664 90 Plus
Dere\GG17356-PA 154 GG17356-PA 22..142 2..123 337 53.3 Plus
Dere\GG17358-PA 152 GG17358-PA 18..136 4..123 307 50.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13770-PA 140 GH13770-PA 1..139 1..139 518 68.3 Plus
Dgri\GH19299-PA 156 GH19299-PA 25..127 4..107 330 61.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32832-PB 140 CG32832-PB 1..140 1..140 747 100 Plus
CG32832-PA 140 CG32832-PA 1..140 1..140 747 100 Plus
CG9399-PD 154 CG9399-PD 22..126 2..107 338 61.3 Plus
CG9399-PA 154 CG9399-PA 22..126 2..107 338 61.3 Plus
CG9399-PB 154 CG9399-PB 22..126 2..107 338 61.3 Plus
CG9396-PA 151 CG9396-PA 16..136 2..123 326 53.3 Plus
CG9399-PE 120 CG9399-PE 2..92 16..107 309 62 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17910-PA 140 GI17910-PA 1..139 1..139 479 61.9 Plus
Dmoj\GI23515-PA 154 GI23515-PA 23..141 4..123 335 54.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19324-PA 140 GL19324-PA 1..140 1..140 585 77.9 Plus
Dper\GL21494-PA 155 GL21494-PA 24..142 4..123 326 51.7 Plus
Dper\GL21495-PA 149 GL21495-PA 14..135 1..123 303 50.4 Plus
Dper\GL16074-PA 141 GL16074-PA 4..140 8..138 250 41.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25919-PA 140 GA25919-PA 1..140 1..140 585 77.9 Plus
Dpse\GA26297-PA 155 GA26297-PA 24..142 4..123 326 51.7 Plus
Dpse\GA26298-PA 149 GA26298-PA 14..135 1..123 303 50.4 Plus
Dpse\GA26115-PA 141 GA26115-PA 4..140 8..138 250 41.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17149-PA 140 GM17149-PA 1..140 1..140 723 97.9 Plus
Dsec\GM26242-PA 154 GM26242-PA 24..126 4..107 330 61.5 Plus
Dsec\GM26243-PA 151 GM26243-PA 23..136 9..123 308 53 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21889-PA 140 GD21889-PA 1..140 1..140 723 97.9 Plus
Dsim\GD20782-PA 154 GD20782-PA 24..142 4..123 333 53.3 Plus
Dsim\GD20783-PA 151 GD20783-PA 16..136 2..123 317 52.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17418-PA 141 GJ17418-PA 1..140 1..140 511 67.1 Plus
Dvir\GJ17419-PA 126 GJ17419-PA 1..124 1..124 442 65.3 Plus
Dvir\GJ10267-PA 157 GJ10267-PA 26..144 4..123 332 54.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18148-PA 91 GK18148-PA 1..87 1..87 361 77 Plus
Dwil\GK11250-PA 154 GK11250-PA 21..139 4..123 338 54.2 Plus
Dwil\GK11251-PA 141 GK11251-PA 15..128 9..123 314 53 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13155-PA 140 GE13155-PA 1..140 1..140 650 85.7 Plus
Dyak\GE24761-PA 152 GE24761-PA 24..142 4..123 333 53.3 Plus
Dyak\GE24762-PA 152 GE24762-PA 18..136 4..123 307 50.8 Plus