Clone MIP16660 Report

Search the DGRC for MIP16660

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:166
Well:60
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34041-RD
Protein status:MIP16660.pep: gold
Sequenced Size:715

Clone Sequence Records

MIP16660.complete Sequence

715 bp assembled on 2010-01-28

GenBank Submission: BT120238.1

> MIP16660.complete
GGTGACTTAAGTTTTGGTTCAAAGTAATGTATTATTTTCCTACCTCAGTC
ATGTGGAGCGCTCTTGGTTTTTCGCCTCTTTTGGCTGTTTTGATTTTACC
CAAATGGGCCTCTTCTACAAAGATGAAAGCCTATTTAGATCTCGATACCC
GATTAAAGACACAATTACGGGGCTACTCGGAAGACCTGCAGGATCACATT
AGTACCTTAAATCGTTATATAGATGATCGAAAATCTGAGCTAGATAAAGT
GGGAAAAGATCCTGAAGTGTATCTGGGCAATCCTCTTAATAGCTTCTCTT
TATTACACCATTTGCACTTTGATTGGCCAGCTTGGAGAAAGCTAATGGAA
AAGCCCTTAGCCACAGAGTACATAACCGAGATTCAAGAGATGTGGAGCGA
GATGCCAACGAAAGATGAATATACGAATTCCATTAAAGCTGCCAAGGATT
TCCATAAGAACGAAACTCAGGGAAATTTTGAATTTAGTCCTTTGGAGTCT
CTGCAAATCGCTCTGCATGCATACGACAAGAAAAACTATACGGAGGCGGA
GAACTGGCTAAATATTACCTTAAATGGTTATAAAAACCTCAGTCTCCAAG
AAAAGGATCTTTATGAAGTTCTAAGTCCTGTTAGTGAGAGTCAGGTGGAG
GATCTTTATACCAAAGTCAGGAAAATAAAAAATGAATAAATAAAATCAAA
AAAAAAAAAAAAAAA

MIP16660.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34041.a 1554 CG34041.a 1..511 123..633 2555 100 Plus
CG34041-RA 1518 CG34041-RA 1..244 123..366 1220 100 Plus
CG34041-RA 1518 CG34041-RA 243..439 437..633 985 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26330538..26330761 3..226 1090 99.1 Plus
chr3R 27901430 chr3R 26331176..26331388 485..697 1035 99.1 Plus
chr3R 27901430 chr3R 26330799..26330951 214..366 765 100 Plus
chr3R 27901430 chr3R 26331007..26331129 365..487 600 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30508023..30508248 1..226 1100 99.1 Plus
3R 32079331 3R 30508663..30508877 485..699 1075 100 Plus
3R 32079331 3R 30508286..30508438 214..366 765 100 Plus
3R 32079331 3R 30508494..30508616 365..487 615 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30248854..30249079 1..226 1100 99.1 Plus
3R 31820162 3R 30249494..30249708 485..699 1075 100 Plus
3R 31820162 3R 30249117..30249269 214..366 765 100 Plus
3R 31820162 3R 30249325..30249447 365..487 615 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:02:37 has no hits.

MIP16660.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:03:46 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26331179..26331388 488..697 99   Plus
chr3R 26330535..26330749 1..214 99 -> Plus
chr3R 26330800..26330951 215..366 100 -> Plus
chr3R 26331009..26331129 367..487 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 09:33:52 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
CG34041-RA 1..244 123..366 100 == Plus
CG34041-RA 245..446 439..641 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:14 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
CG34041-RD 1..663 27..689 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:41:22 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
CG34041-RD 1..663 27..689 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:47:27 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
CG34041-RD 1..663 27..689 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 09:33:51 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
CG34041-RA 1..244 123..366 100 == Plus
CG34041-RA 245..446 439..641 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:13 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
CG34041-RD 1..697 1..697 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:41:22 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
CG34041-RD 1..697 1..697 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:47:27 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
CG34041-RD 1..697 1..697 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:03:46 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30508023..30508236 1..214 100 -> Plus
3R 30508287..30508438 215..366 100 -> Plus
3R 30508496..30508616 367..487 100 -> Plus
3R 30508666..30508875 488..697 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:03:46 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30508023..30508236 1..214 100 -> Plus
3R 30508287..30508438 215..366 100 -> Plus
3R 30508496..30508616 367..487 100 -> Plus
3R 30508666..30508875 488..697 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:03:46 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30508023..30508236 1..214 100 -> Plus
3R 30508287..30508438 215..366 100 -> Plus
3R 30508496..30508616 367..487 100 -> Plus
3R 30508666..30508875 488..697 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:41:22 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26333745..26333958 1..214 100 -> Plus
arm_3R 26334009..26334160 215..366 100 -> Plus
arm_3R 26334218..26334338 367..487 100 -> Plus
arm_3R 26334388..26334597 488..697 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:55 Download gff for MIP16660.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30249497..30249706 488..697 100   Plus
3R 30248854..30249067 1..214 100 -> Plus
3R 30249118..30249269 215..366 100 -> Plus
3R 30249327..30249447 367..487 100 -> Plus

MIP16660.hyp Sequence

Translation from 26 to 688

> MIP16660.hyp
MYYFPTSVMWSALGFSPLLAVLILPKWASSTKMKAYLDLDTRLKTQLRGY
SEDLQDHISTLNRYIDDRKSELDKVGKDPEVYLGNPLNSFSLLHHLHFDW
PAWRKLMEKPLATEYITEIQEMWSEMPTKDEYTNSIKAAKDFHKNETQGN
FEFSPLESLQIALHAYDKKNYTEAENWLNITLNGYKNLSLQEKDLYEVLS
PVSESQVEDLYTKVRKIKNE*

MIP16660.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG34041-PD 220 CG34041-PD 1..220 1..220 1164 100 Plus
CG34041-PE 549 CG34041-PE 1..202 1..202 1076 100 Plus
CG34041-PF 568 CG34041-PF 1..202 1..202 1076 100 Plus
CG31021-PB 453 CG31021-PB 2..195 37..220 271 29.1 Plus
PH4alphaPV-PA 525 CG31015-PA 39..227 33..213 213 27.2 Plus

MIP16660.pep Sequence

Translation from 26 to 688

> MIP16660.pep
MYYFPTSVMWSALGFSPLLAVLILPKWASSTKMKAYLDLDTRLKTQLRGY
SEDLQDHISTLNRYIDDRKSELDKVGKDPEVYLGNPLNSFSLLHHLHFDW
PAWRKLMEKPLATEYITEIQEMWSEMPTKDEYTNSIKAAKDFHKNETQGN
FEFSPLESLQIALHAYDKKNYTEAENWLNITLNGYKNLSLQEKDLYEVLS
PVSESQVEDLYTKVRKIKNE*

MIP16660.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22914-PA 501 GF22914-PA 22..200 28..196 228 28.6 Plus
Dana\GF23317-PA 520 GF23317-PA 32..209 29..192 184 27.5 Plus
Dana\GF23631-PA 502 GF23631-PA 3..195 33..214 147 23.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:52:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11765-PA 452 GG11765-PA 2..175 37..200 260 30.2 Plus
Dere\GG11918-PA 525 GG11918-PA 35..227 29..213 218 28.4 Plus
Dere\GG11767-PA 536 GG11767-PA 42..225 40..213 165 26.1 Plus
Dere\GG11919-PA 533 GG11919-PA 31..131 29..129 161 33.7 Plus
Dere\GG13662-PA 515 GG13662-PA 55..232 50..207 155 26.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14105-PA 513 GH14105-PA 27..199 29..187 194 26 Plus
Dgri\GH14106-PA 511 GH14106-PA 111..222 29..140 144 27.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG34041-PD 220 CG34041-PD 1..220 1..220 1164 100 Plus
CG34041-PE 549 CG34041-PE 1..202 1..202 1076 100 Plus
CG34041-PF 568 CG34041-PF 1..202 1..202 1076 100 Plus
CG31021-PB 453 CG31021-PB 2..195 37..220 271 29.1 Plus
PH4alphaPV-PA 525 CG31015-PA 39..227 33..213 213 27.2 Plus
CG18231-PB 470 CG18231-PB 17..186 27..182 175 22.9 Plus
CG18233-PB 515 CG18233-PB 55..229 50..216 165 24.9 Plus
CG31013-PA 534 CG31013-PA 31..230 29..209 160 24.5 Plus
CG32199-PB 509 CG32199-PB 6..197 29..197 159 22.9 Plus
CG31016-PC 536 CG31016-PC 39..140 37..138 158 31.4 Plus
CG31016-PB 536 CG31016-PB 39..140 37..138 158 31.4 Plus
CG15864-PB 490 CG15864-PB 34..210 28..187 151 26.6 Plus
CG4174-PF 473 CG4174-PF 7..199 8..185 150 25.5 Plus
CG4174-PE 473 CG4174-PE 7..199 8..185 150 25.5 Plus
CG4174-PD 473 CG4174-PD 7..199 8..185 150 25.5 Plus
CG18749-PC 491 CG18749-PC 34..211 28..188 149 26.4 Plus
CG18749-PB 491 CG18749-PB 34..211 28..188 149 26.4 Plus
PH4alphaNE3-PA 481 CG31017-PA 28..201 37..199 147 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10646-PA 471 GI10646-PA 33..206 28..185 207 31 Plus
Dmoj\GI10637-PA 529 GI10637-PA 39..202 29..178 170 22.8 Plus
Dmoj\GI22115-PA 498 GI22115-PA 25..184 37..182 164 26.7 Plus
Dmoj\GI22114-PA 487 GI22114-PA 25..183 37..181 159 26.2 Plus
Dmoj\GI13596-PA 527 GI13596-PA 32..200 28..182 154 25.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13505-PA 480 GL13505-PA 26..204 32..200 236 27.6 Plus
Dper\GL13466-PA 643 GL13466-PA 1..113 9..112 193 37.2 Plus
Dper\GL13994-PA 493 GL13994-PA 1..189 33..213 184 25.1 Plus
Dper\GL13508-PA 338 GL13508-PA 29..192 29..178 178 27.4 Plus
Dper\GL13995-PA 535 GL13995-PA 50..213 29..178 174 27.4 Plus
Dper\GL13466-PA 643 GL13466-PA 157..322 32..183 153 23.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15945-PA 480 GA15945-PA 26..204 32..200 236 27.6 Plus
Dpse\GA15939-PA 528 GA15939-PA 32..224 29..213 189 25.6 Plus
Dpse\GA26874-PA 372 GA26874-PA 29..192 29..178 178 27.4 Plus
Dpse\GA15937-PA 510 GA15937-PA 29..192 29..178 178 27.4 Plus
Dpse\GA23909-PA 530 GA23909-PA 54..210 50..190 172 28.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12886-PA 146 GM12886-PA 2..117 64..203 542 76.4 Plus
Dsec\GM12896-PA 453 GM12896-PA 2..175 37..200 238 29.6 Plus
Dsec\GM12139-PA 525 GM12139-PA 35..227 29..213 187 26.4 Plus
Dsec\GM12898-PA 536 GM12898-PA 39..225 37..213 157 25.7 Plus
Dsec\GM14979-PA 461 GM14979-PA 44..203 37..182 156 23.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21525-PA 146 GD21525-PA 2..116 64..202 539 77 Plus
Dsim\GD21535-PA 453 GD21535-PA 2..175 37..200 247 30.2 Plus
Dsim\GD16902-PA 525 GD16902-PA 35..227 29..213 194 26.4 Plus
Dsim\GD16913-PA 534 GD16913-PA 31..230 29..209 152 25.1 Plus
Dsim\GD18524-PA 472 GD18524-PA 10..192 23..187 152 27.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22993-PA 525 GJ22993-PA 38..216 29..190 160 24 Plus
Dvir\GJ13932-PA 444 GJ13932-PA 19..146 46..180 159 30.1 Plus
Dvir\GJ24231-PA 155 GJ24231-PA 22..146 29..151 155 24.8 Plus
Dvir\GJ23004-PA 446 GJ23004-PA 2..159 43..185 151 27.8 Plus
Dvir\GJ13933-PA 521 GJ13933-PA 32..194 28..182 147 29.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:52:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14147-PA 481 GK14147-PA 2..212 15..214 244 28 Plus
Dwil\GK14148-PA 444 GK14148-PA 5..171 31..183 169 28.7 Plus
Dwil\GK14149-PA 496 GK14149-PA 2..169 30..183 169 28 Plus
Dwil\GK14138-PA 518 GK14138-PA 35..211 29..185 166 25.8 Plus
Dwil\GK13116-PA 521 GK13116-PA 13..205 15..186 160 27.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10886-PA 157 GE10886-PA 10..127 61..202 474 66.9 Plus
Dyak\GE10892-PA 481 GE10892-PA 7..224 17..220 283 30.5 Plus
Dyak\GE23368-PA 528 GE23368-PA 35..227 29..213 209 28.4 Plus
Dyak\GE19961-PA 441 GE19961-PA 34..203 27..182 161 23.5 Plus
Dyak\GE10893-PA 508 GE10893-PA 22..202 30..200 156 27.3 Plus