Clone MIP16670 Report

Search the DGRC for MIP16670

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:166
Well:70
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42467-RA
Protein status:MIP16670.pep: Inserted from web
Sequenced Size:290

Clone Sequence Records

MIP16670.complete Sequence

290 bp assembled on 2011-03-07

GenBank Submission: BT126119.1

> MIP16670.complete
ATTATTCACTCATTGCTAATGAGATCGTTTTGTGTGTCTGTCTTATTAGT
TACCCTTTTGGGGATTGCGATGGCATATAGAGATTATTCGGAGAAGTGCT
ATCAATCCCCTCGGTCTTATGGACCTTGTAATGTTAAGGCCCATGGATAC
ACTTATGATTCTCGTAGAAATGTATGTCGTCGAATTGTTCTTCGGTGTAT
GGCAAGGGGTAACTATTTCTTTGACAAAGATTCCTGCGAATACACATGCT
TAAAGCATATTCAGGAAAAAAAAAAAAAAAAAAAAAAAAA

MIP16670.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:18:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3700928..3701106 86..264 865 98.9 Plus
chr2L 23010047 chr2L 3700795..3700878 2..85 405 98.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3701423..3701612 86..275 905 98.4 Plus
2L 23513712 2L 3701290..3701373 2..85 420 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3701423..3701612 86..275 905 98.4 Plus
2L 23513712 2L 3701290..3701373 2..85 420 100 Plus
Blast to na_te.dros performed 2019-03-16 22:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 3069..3127 67..10 103 66.1 Minus
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 289..347 67..10 103 66.1 Minus
roo 9092 roo DM_ROO 9092bp 7829..7914 165..248 100 62.1 Plus

MIP16670.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:35 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3700794..3700878 1..85 97 -> Plus
chr2L 3700928..3701106 86..265 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-07 14:04:12 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
CG42467-RA 1..246 19..265 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:53:50 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
CG42467-RA 1..249 19..267 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:18 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
CG42467-RA 1..249 19..267 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-07 14:04:11 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
CG42467-RA 1..246 19..265 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:53:50 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
CG42467-RA 1..263 2..265 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:18 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
CG42467-RA 1..263 2..265 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:35 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3701289..3701373 1..85 98 -> Plus
2L 3701423..3701601 86..265 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:35 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3701289..3701373 1..85 98 -> Plus
2L 3701423..3701601 86..265 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:35 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3701289..3701373 1..85 98 -> Plus
2L 3701423..3701601 86..265 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:53:50 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3701289..3701373 1..85 98 -> Plus
arm_2L 3701423..3701601 86..265 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:40 Download gff for MIP16670.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3701289..3701373 1..85 98 -> Plus
2L 3701423..3701601 86..265 99   Plus

MIP16670.hyp Sequence

Translation from 0 to 265

> MIP16670.hyp
FIHSLLMRSFCVSVLLVTLLGIAMAYRDYSEKCYQSPRSYGPCNVKAHGY
TYDSRRNVCRRIVLRCMARGNYFFDKDSCEYTCLKHIQ

MIP16670.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42467-PA 82 CG42467-PA 1..82 7..88 452 100 Plus
Sfp24C1-PA 80 CG42466-PA 1..78 7..87 143 40.7 Plus

MIP16670.pep Sequence

Translation from 18 to 288

> MIP16670.pep
MRSFCVSVLLVTLLGIAMAYRDYSEKCYQSPRSYGPCNVKAHGYTYDSRR
NVCRRIVLRCMARGNYFFDKDSCEYTCLKHIQEKKKKKKK

MIP16670.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42467-PA 82 CG42467-PA 1..82 1..82 452 100 Plus
Sfp24C1-PA 80 CG42466-PA 1..78 1..81 143 40.7 Plus