Clone Sequence Records
MIP16670.complete Sequence
290 bp assembled on 2011-03-07
GenBank Submission: BT126119.1
> MIP16670.complete
ATTATTCACTCATTGCTAATGAGATCGTTTTGTGTGTCTGTCTTATTAGT
TACCCTTTTGGGGATTGCGATGGCATATAGAGATTATTCGGAGAAGTGCT
ATCAATCCCCTCGGTCTTATGGACCTTGTAATGTTAAGGCCCATGGATAC
ACTTATGATTCTCGTAGAAATGTATGTCGTCGAATTGTTCTTCGGTGTAT
GGCAAGGGGTAACTATTTCTTTGACAAAGATTCCTGCGAATACACATGCT
TAAAGCATATTCAGGAAAAAAAAAAAAAAAAAAAAAAAAA
MIP16670.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:18:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 3700928..3701106 | 86..264 | 865 | 98.9 | Plus |
chr2L | 23010047 | chr2L | 3700795..3700878 | 2..85 | 405 | 98.8 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:18:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3701423..3701612 | 86..275 | 905 | 98.4 | Plus |
2L | 23513712 | 2L | 3701290..3701373 | 2..85 | 420 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3701423..3701612 | 86..275 | 905 | 98.4 | Plus |
2L | 23513712 | 2L | 3701290..3701373 | 2..85 | 420 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 22:18:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Penelope | 4158 | Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). | 3069..3127 | 67..10 | 103 | 66.1 | Minus |
Dvir\Penelope | 4158 | Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). | 289..347 | 67..10 | 103 | 66.1 | Minus |
roo | 9092 | roo DM_ROO 9092bp | 7829..7914 | 165..248 | 100 | 62.1 | Plus |
MIP16670.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:35 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 3700794..3700878 | 1..85 | 97 | -> | Plus |
chr2L | 3700928..3701106 | 86..265 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-07 14:04:12 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42467-RA | 1..246 | 19..265 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:53:50 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42467-RA | 1..249 | 19..267 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:18 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42467-RA | 1..249 | 19..267 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-07 14:04:11 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42467-RA | 1..246 | 19..265 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:53:50 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42467-RA | 1..263 | 2..265 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:18 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42467-RA | 1..263 | 2..265 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:35 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3701289..3701373 | 1..85 | 98 | -> | Plus |
2L | 3701423..3701601 | 86..265 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:35 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3701289..3701373 | 1..85 | 98 | -> | Plus |
2L | 3701423..3701601 | 86..265 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:35 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3701289..3701373 | 1..85 | 98 | -> | Plus |
2L | 3701423..3701601 | 86..265 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:53:50 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3701289..3701373 | 1..85 | 98 | -> | Plus |
arm_2L | 3701423..3701601 | 86..265 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:40 Download gff for
MIP16670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3701289..3701373 | 1..85 | 98 | -> | Plus |
2L | 3701423..3701601 | 86..265 | 99 | | Plus |
MIP16670.hyp Sequence
Translation from 0 to 265
> MIP16670.hyp
FIHSLLMRSFCVSVLLVTLLGIAMAYRDYSEKCYQSPRSYGPCNVKAHGY
TYDSRRNVCRRIVLRCMARGNYFFDKDSCEYTCLKHIQ
MIP16670.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:32:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42467-PA | 82 | CG42467-PA | 1..82 | 7..88 | 452 | 100 | Plus |
Sfp24C1-PA | 80 | CG42466-PA | 1..78 | 7..87 | 143 | 40.7 | Plus |
MIP16670.pep Sequence
Translation from 18 to 288
> MIP16670.pep
MRSFCVSVLLVTLLGIAMAYRDYSEKCYQSPRSYGPCNVKAHGYTYDSRR
NVCRRIVLRCMARGNYFFDKDSCEYTCLKHIQEKKKKKKK
MIP16670.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42467-PA | 82 | CG42467-PA | 1..82 | 1..82 | 452 | 100 | Plus |
Sfp24C1-PA | 80 | CG42466-PA | 1..78 | 1..81 | 143 | 40.7 | Plus |