Clone MIP16722 Report

Search the DGRC for MIP16722

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:167
Well:22
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG14635-RA
Protein status:MIP16722.pep: gold
Sequenced Size:502

Clone Sequence Records

MIP16722.complete Sequence

502 bp assembled on 2010-01-27

GenBank Submission: BT120226.1

> MIP16722.complete
CAGAAGCAACAAATATGTGCTCTAGTTTAAGCGACTTGTTTGCCTGTATC
AGGGCCCAGGGAAATTCCGACACGGATTCCACCAGCACCACCCATCGGCG
GAATATCGCTGACCTGGACGATGAGGCGCCCGATCTGCAGCTCCAACAGG
AGCAGACCCGCAAGTGGAACGATCTTTCTATGCCACAGCGACACGATTCG
TTTCCAGTTCCTCCTCCTTCAGCTGGATCTCCATCAACGGGCTACCTTCG
TCCCTCATTGCGGTCAGCACGGGTCTCCTACGAAGCCTTGGAGCGCTACG
ATCGAATTTTTGGCAGATCTTTCCAAGACGCCGGGTCATCTGGTTCAGTT
CGAAATATTCCCGACCAGTTCTAGGCGGAAATTGTTTGGGATTTCGGCAT
TGACATTAAACATGTGATCCCGCATATTCCGCTAAAAGTCGAACACAATA
AATACATTTTACACATTTTCCTGACAAAAAAAAAAAAAAAAAAAAAAAAA
AA

MIP16722.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG14635-RA 360 CG14635-RA 1..360 15..374 1800 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 738761..739235 1..475 2375 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 844823..845297 1..475 2375 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 852921..853395 1..475 2375 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:53:06 has no hits.

MIP16722.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:54:17 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 738761..739235 1..475 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-27 19:48:48 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 1..360 15..374 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:12:51 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 1..360 15..374 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:38:35 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 1..360 15..374 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:37:24 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 1..360 15..374 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-27 19:48:47 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 1..360 15..374 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:12:51 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 1..360 15..374 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:38:35 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 1..475 1..475 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:37:24 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
CG14635-RA 1..475 1..475 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:17 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
X 844823..845297 1..475 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:17 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
X 844823..845297 1..475 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:17 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
X 844823..845297 1..475 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:38:35 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 738856..739330 1..475 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:40 Download gff for MIP16722.complete
Subject Subject Range Query Range Percent Splice Strand
X 852921..853395 1..475 100   Plus

MIP16722.pep Sequence

Translation from 2 to 373

> MIP16722.pep
EATNMCSSLSDLFACIRAQGNSDTDSTSTTHRRNIADLDDEAPDLQLQQE
QTRKWNDLSMPQRHDSFPVPPPSAGSPSTGYLRPSLRSARVSYEALERYD
RIFGRSFQDAGSSGSVRNIPDQF*

MIP16722.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22108-PA 125 GF22108-PA 1..125 5..123 213 43.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12813-PA 118 GG12813-PA 1..118 5..123 459 77.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14635-PA 119 CG14635-PA 1..119 5..123 624 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14203-PA 134 GL14203-PA 1..134 5..123 173 40 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13133-PA 134 GA13133-PA 1..134 5..123 173 40 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19095-PA 119 GM19095-PA 1..119 5..123 537 88.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16532-PA 119 GD16532-PA 1..119 5..123 541 88.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16643-PA 111 GE16643-PA 1..111 5..123 436 73.9 Plus

MIP16722.hyp Sequence

Translation from 2 to 373

> MIP16722.hyp
EATNMCSSLSDLFACIRAQGNSDTDSTSTTHRRNIADLDDEAPDLQLQQE
QTRKWNDLSMPQRHDSFPVPPPSAGSPSTGYLRPSLRSARVSYEALERYD
RIFGRSFQDAGSSGSVRNIPDQF*

MIP16722.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG14635-PA 119 CG14635-PA 1..119 5..123 624 100 Plus