MIP16722.complete Sequence
502 bp assembled on 2010-01-27
GenBank Submission: BT120226.1
> MIP16722.complete
CAGAAGCAACAAATATGTGCTCTAGTTTAAGCGACTTGTTTGCCTGTATC
AGGGCCCAGGGAAATTCCGACACGGATTCCACCAGCACCACCCATCGGCG
GAATATCGCTGACCTGGACGATGAGGCGCCCGATCTGCAGCTCCAACAGG
AGCAGACCCGCAAGTGGAACGATCTTTCTATGCCACAGCGACACGATTCG
TTTCCAGTTCCTCCTCCTTCAGCTGGATCTCCATCAACGGGCTACCTTCG
TCCCTCATTGCGGTCAGCACGGGTCTCCTACGAAGCCTTGGAGCGCTACG
ATCGAATTTTTGGCAGATCTTTCCAAGACGCCGGGTCATCTGGTTCAGTT
CGAAATATTCCCGACCAGTTCTAGGCGGAAATTGTTTGGGATTTCGGCAT
TGACATTAAACATGTGATCCCGCATATTCCGCTAAAAGTCGAACACAATA
AATACATTTTACACATTTTCCTGACAAAAAAAAAAAAAAAAAAAAAAAAA
AA
MIP16722.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:39:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14635-RA | 360 | CG14635-RA | 1..360 | 15..374 | 1800 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:53:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 738761..739235 | 1..475 | 2375 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:53:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 844823..845297 | 1..475 | 2375 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 852921..853395 | 1..475 | 2375 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 14:53:06 has no hits.
MIP16722.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:54:17 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 738761..739235 | 1..475 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-27 19:48:48 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14635-RA | 1..360 | 15..374 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:12:51 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14635-RA | 1..360 | 15..374 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:38:35 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14635-RA | 1..360 | 15..374 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:37:24 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14635-RA | 1..360 | 15..374 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-27 19:48:47 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14635-RA | 1..360 | 15..374 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:12:51 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14635-RA | 1..360 | 15..374 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:38:35 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14635-RA | 1..475 | 1..475 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:37:24 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14635-RA | 1..475 | 1..475 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:17 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 844823..845297 | 1..475 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:17 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 844823..845297 | 1..475 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:17 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 844823..845297 | 1..475 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:38:35 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 738856..739330 | 1..475 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:40 Download gff for
MIP16722.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 852921..853395 | 1..475 | 100 | | Plus |
MIP16722.pep Sequence
Translation from 2 to 373
> MIP16722.pep
EATNMCSSLSDLFACIRAQGNSDTDSTSTTHRRNIADLDDEAPDLQLQQE
QTRKWNDLSMPQRHDSFPVPPPSAGSPSTGYLRPSLRSARVSYEALERYD
RIFGRSFQDAGSSGSVRNIPDQF*
MIP16722.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:50:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF22108-PA | 125 | GF22108-PA | 1..125 | 5..123 | 213 | 43.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:50:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG12813-PA | 118 | GG12813-PA | 1..118 | 5..123 | 459 | 77.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14635-PA | 119 | CG14635-PA | 1..119 | 5..123 | 624 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:50:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL14203-PA | 134 | GL14203-PA | 1..134 | 5..123 | 173 | 40 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:50:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA13133-PA | 134 | GA13133-PA | 1..134 | 5..123 | 173 | 40 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:50:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19095-PA | 119 | GM19095-PA | 1..119 | 5..123 | 537 | 88.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:50:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD16532-PA | 119 | GD16532-PA | 1..119 | 5..123 | 541 | 88.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:50:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE16643-PA | 111 | GE16643-PA | 1..111 | 5..123 | 436 | 73.9 | Plus |
MIP16722.hyp Sequence
Translation from 2 to 373
> MIP16722.hyp
EATNMCSSLSDLFACIRAQGNSDTDSTSTTHRRNIADLDDEAPDLQLQQE
QTRKWNDLSMPQRHDSFPVPPPSAGSPSTGYLRPSLRSARVSYEALERYD
RIFGRSFQDAGSSGSVRNIPDQF*
MIP16722.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:24:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14635-PA | 119 | CG14635-PA | 1..119 | 5..123 | 624 | 100 | Plus |