Clone MIP16728 Report

Search the DGRC for MIP16728

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:167
Well:28
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG15526-RA
Protein status:MIP16728.pep: gold
Sequenced Size:584

Clone Sequence Records

MIP16728.complete Sequence

584 bp assembled on 2010-01-27

GenBank Submission: BT120229.1

> MIP16728.complete
AAAATTTGACTATTTGTTGTTTCGAGTTTCGTTATTTAAATTGCACGTCT
TGCGTGAGAGAATTTCGACAAAGACTGCGCGGCGCGCAATTCACTGCAAA
ATCAGTTTGCCAATCGCCCCGAACGCACAAAACTCTATCACTACAGAGGA
TCCCGCTTAAAAGGAACGCGCAAGATCACCATGGCGAACTATTACTATTT
CGACATCAAACTTAAACTTCGGGATCCGACTGCAGTTGCTTTGACCCCAT
CTCTGTTTCGAAGCTGCGTTCTTGACGCCCTGGACAGTTTCTTCTGCGAG
GAGAAACCCACACTGGAGATCGTGAAGTTCTGCGCCCAGCAACATCGTGT
TATCTTTCGAGTGCCAGAGCAACTGCACGACATGACCCGCATATCCATTG
AGCTCATCGGTCACTACCAGCAGATACCCTGTCATTTTGAGATCTTGGAA
ACATCCAAATCATCGCTGGACTTTGAGAAGAGCATTGAAAAGACTGTCGC
GGTTGTGTCCGATGATTAGGACTAGCGAATTGTAATACTCAGTGTAATAT
ACATTATAACCGTCATGAAAAAAAAAAAAAAAAA

MIP16728.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15526-RA 541 CG15526-RA 1..426 144..569 2130 100 Plus
spn-A-RA 1330 spn-A-RA 1..125 126..2 625 100 Minus
spn-A-RB 1338 spn-A-RB 1..77 78..2 385 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25878664..25879018 213..567 1775 100 Plus
chr3R 27901430 chr3R 25878372..25878582 2..212 1055 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30056249..30056605 213..569 1785 100 Plus
3R 32079331 3R 30055957..30056167 2..212 1055 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29797080..29797436 213..569 1785 100 Plus
3R 31820162 3R 29796788..29796998 2..212 1055 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:17:45 has no hits.

MIP16728.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:18:42 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25878371..25878582 1..212 99 -> Plus
chr3R 25878664..25879018 213..567 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-27 19:48:45 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 1..339 181..519 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:12:57 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 1..339 181..519 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:09 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 1..339 181..519 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:37:17 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 1..339 181..519 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-27 19:48:44 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 1..339 181..519 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:12:57 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 1..339 181..519 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:09 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 1..566 2..567 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:37:17 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
CG15526-RA 1..566 2..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:42 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30055956..30056167 1..212 99 -> Plus
3R 30056249..30056603 213..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:42 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30055956..30056167 1..212 99 -> Plus
3R 30056249..30056603 213..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:42 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30055956..30056167 1..212 99 -> Plus
3R 30056249..30056603 213..567 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:09 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25881678..25881889 1..212 99 -> Plus
arm_3R 25881971..25882325 213..567 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:43 Download gff for MIP16728.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29796787..29796998 1..212 99 -> Plus
3R 29797080..29797434 213..567 100   Plus

MIP16728.pep Sequence

Translation from 180 to 518

> MIP16728.pep
MANYYYFDIKLKLRDPTAVALTPSLFRSCVLDALDSFFCEEKPTLEIVKF
CAQQHRVIFRVPEQLHDMTRISIELIGHYQQIPCHFEILETSKSSLDFEK
SIEKTVAVVSDD*

MIP16728.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18820-PA 74 GF18820-PA 1..72 1..72 305 79.2 Plus
Dana\GF18821-PA 101 GF18821-PA 1..101 1..99 229 42.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11731-PA 114 GG11731-PA 1..110 1..110 515 88.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19177-PA 241 GH19177-PA 1..84 1..82 221 48.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG15526-PA 112 CG15526-PA 1..112 1..112 581 100 Plus
CG34317-PA 111 CG34317-PA 1..109 1..107 283 51.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24211-PA 113 GI24211-PA 1..102 1..100 305 54.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14026-PA 112 GL14026-PA 1..109 1..107 350 55 Plus
Dper\GL14027-PA 111 GL14027-PA 1..108 1..106 279 45.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13784-PA 112 GA13784-PA 1..109 1..107 356 56 Plus
Dpse\GA26936-PA 111 GA26936-PA 1..108 1..106 278 45.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12859-PA 112 GM12859-PA 1..112 1..112 563 95.5 Plus
Dsec\GM12860-PA 111 GM12860-PA 1..109 1..107 293 51.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21501-PA 113 GD21501-PA 1..112 1..112 566 96.4 Plus
Dsim\GD21502-PA 111 GD21502-PA 1..109 1..107 293 51.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10781-PA 120 GJ10781-PA 1..104 1..102 309 55.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13870-PA 114 GK13870-PA 1..109 1..107 349 55 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10856-PA 114 GE10856-PA 1..111 1..111 500 82 Plus
Dyak\GE10857-PA 111 GE10857-PA 1..109 1..107 290 52.3 Plus

MIP16728.hyp Sequence

Translation from 180 to 518

> MIP16728.hyp
MANYYYFDIKLKLRDPTAVALTPSLFRSCVLDALDSFFCEEKPTLEIVKF
CAQQHRVIFRVPEQLHDMTRISIELIGHYQQIPCHFEILETSKSSLDFEK
SIEKTVAVVSDD*

MIP16728.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15526-PA 112 CG15526-PA 1..112 1..112 581 100 Plus
CG34317-PA 111 CG34317-PA 1..109 1..107 283 51.4 Plus