BDGP Sequence Production Resources |
Search the DGRC for MIP16731
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 167 |
Well: | 31 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | CG15571-RA |
Protein status: | MIP16731.pep: gold |
Sequenced Size: | 570 |
570 bp assembled on 2010-01-27
GenBank Submission: BT120230.1
> MIP16731.complete GTGCAGTGCCTAAAGAACTTAGAACAATTAACTCGATCGAAATGACAGCC TTCAATAGGGATCATCACTTCGCGTTTCTAATGATCGTTGCCCTCGTGGG AAGTAGCTGTATTTTAGGATTTTCCGATGCCCAAACCTTCACAGCCGAGG ATCGTAGCTCTATACAGAAATTCATGGATTCATTGTTGAACTTCCTGGAA CTGGAAATTAGTAATATAACAACCACATTGCCGCCAACTTCGAATGGCAC TACCTTGGAGACCACTACTCTGGCACCTGGAAATTCCACAGAAGTGACCA CAGAGGTTTCGCAAACATCTACTAACTCCACATCGAGTGCCTTGGATACG ACCACGAGCAGTTTGAATTCCACAACGGAGGATAGCGAAAATACAACCGC AACCACAACCACCGAAGCAAATCCCACTACTATGAGGCGCAGGATTTGCT TCAAGCGTTTCTGCTACAAGTTTAGCAACGACAAGGGTTACATAGTTTAG ATCAAATAAACGTATAGATATGAAAAAAAAAAAAAAATTAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15571-RA | 459 | CG15571-RA | 1..459 | 42..500 | 2295 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 4109965..4110491 | 527..1 | 2530 | 98.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 4216868..4217394 | 527..1 | 2620 | 99.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 4224966..4225492 | 527..1 | 2620 | 99.8 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 4109970..4110491 | 1..522 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15571-RA | 1..459 | 42..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15571-RA | 1..459 | 42..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15571-RA | 1..459 | 42..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15571-RA | 1..459 | 42..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15571-RA | 1..459 | 42..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15571-RA | 1..459 | 42..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15571-RA | 1..522 | 1..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15571-RA | 1..522 | 1..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4216873..4217394 | 1..522 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4216873..4217394 | 1..522 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4216873..4217394 | 1..522 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 4110906..4111427 | 1..522 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 4224971..4225492 | 1..522 | 100 | Minus |
Translation from 2 to 499
> MIP16731.hyp AVPKELRTINSIEMTAFNRDHHFAFLMIVALVGSSCILGFSDAQTFTAED RSSIQKFMDSLLNFLELEISNITTTLPPTSNGTTLETTTLAPGNSTEVTT EVSQTSTNSTSSALDTTTSSLNSTTEDSENTTATTTTEANPTTMRRRICF KRFCYKFSNDKGYIV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15571-PA | 152 | CG15571-PA | 1..152 | 14..165 | 770 | 100 | Plus |
Translation from 2 to 499
> MIP16731.pep AVPKELRTINSIEMTAFNRDHHFAFLMIVALVGSSCILGFSDAQTFTAED RSSIQKFMDSLLNFLELEISNITTTLPPTSNGTTLETTTLAPGNSTEVTT EVSQTSTNSTSSALDTTTSSLNSTTEDSENTTATTTTEANPTTMRRRICF KRFCYKFSNDKGYIV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21489-PA | 154 | GF21489-PA | 2..154 | 20..165 | 260 | 48.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18557-PA | 156 | GG18557-PA | 1..156 | 14..165 | 502 | 82.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24677-PA | 166 | GH24677-PA | 1..166 | 14..165 | 256 | 39.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15571-PA | 152 | CG15571-PA | 1..152 | 14..165 | 770 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16145-PA | 158 | GI16145-PA | 1..157 | 14..164 | 259 | 42 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14195-PA | 142 | GL14195-PA | 1..141 | 14..164 | 255 | 50.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13820-PA | 142 | GA13820-PA | 1..141 | 14..164 | 256 | 50.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12700-PA | 154 | GM12700-PA | 1..154 | 14..165 | 545 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16309-PA | 154 | GD16309-PA | 1..154 | 14..165 | 543 | 87.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16421-PA | 170 | GJ16421-PA | 1..169 | 14..164 | 238 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17599-PA | 148 | GK17599-PA | 3..147 | 20..164 | 225 | 48 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16868-PA | 145 | GE16868-PA | 1..145 | 14..165 | 561 | 80.9 | Plus |