Clone MIP16764 Report

Search the DGRC for MIP16764

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:167
Well:64
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34283-RA
Protein status:MIP16764.pep: gold
Sequenced Size:599

Clone Sequence Records

MIP16764.complete Sequence

599 bp assembled on 2010-01-28

GenBank Submission: BT120237.1

> MIP16764.complete
ATCTAATCAAGATTTGAAAAATCAAAAGACAATTGCTGTTGTATCAACAA
ATCCTTTAAAAGTGCAAAATGTCTAAAAGCAACGCATCTGTGGAAGGTCC
CCGTTTTGAGGAGCACCTAGTCTGTCCATTCGATGGATTACATCGCATAT
TGCCGCTCGATATGAAGACGCACGTGTTGCAGTGCGCCAAGAACTTTCCT
TTGGAAAAGTTGGTGCACTGTCCATATAACTGCGGTCAAATACACTCGGT
TGCCGAAATGGAGAATCATATCAATGATTGTCCAGACCGAGCATATTTGG
AGCGCAACAATGTGCCTAGTGATGAGTTGCCTTCTTTGGCACAGCGACCG
CGTGGTGTTGAGGTGGAGAGCGAAGAGGATTGGGATGCCGAACCGCCATC
TCAGACGTACAACCCTAGTCTTCACTGCGAGAGGAGCATGGTTATCCGTA
CCATACATGGAGCTACACGATCCGCTCGTCGAGAATTCCGCAAACGCGAG
CAAAAGCGATTAAATGATTTAAATCCATAGATCAAGTTTACGAGTAGTAA
AATAAAGAGCACAGCTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP16764.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34283-RA 744 CG34283-RA 160..731 1..572 2860 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14546428..14546691 263..1 1270 99.6 Minus
chr3R 27901430 chr3R 14546082..14546372 567..262 1240 94.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18721962..18722272 572..262 1555 100 Minus
3R 32079331 3R 18722328..18722590 263..1 1315 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18462793..18463103 572..262 1555 100 Minus
3R 31820162 3R 18463159..18463421 263..1 1315 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:17:58 has no hits.

MIP16764.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:18:50 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14546082..14546321 328..567 99 == Minus
chr3R 14546322..14546370 264..312 100 <- Minus
chr3R 14546428..14546691 1..263 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 09:29:05 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
CG34283-RA 1..462 69..530 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:12 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
CG34283-RA 1..462 69..530 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:16 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
CG34283-RA 1..462 69..530 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:37:31 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
CG34283-RA 1..462 69..530 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 09:29:04 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
CG34283-RA 1..462 69..530 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:12 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
CG34283-RA 1..462 69..530 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:16 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
CG34283-RA 1..462 69..530 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:37:31 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
CG34283-RA 1..567 1..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:50 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18721967..18722270 264..567 100 <- Minus
3R 18722328..18722590 1..263 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:50 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18721967..18722270 264..567 100 <- Minus
3R 18722328..18722590 1..263 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:18:50 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18721967..18722270 264..567 100 <- Minus
3R 18722328..18722590 1..263 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:16 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14548050..14548312 1..263 100   Minus
arm_3R 14547689..14547992 264..567 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:54 Download gff for MIP16764.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18463159..18463421 1..263 100   Minus
3R 18462798..18463101 264..567 100 <- Minus

MIP16764.pep Sequence

Translation from 68 to 529

> MIP16764.pep
MSKSNASVEGPRFEEHLVCPFDGLHRILPLDMKTHVLQCAKNFPLEKLVH
CPYNCGQIHSVAEMENHINDCPDRAYLERNNVPSDELPSLAQRPRGVEVE
SEEDWDAEPPSQTYNPSLHCERSMVIRTIHGATRSARREFRKREQKRLND
LNP*

MIP16764.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22344-PA 154 GF22344-PA 3..136 2..136 340 45.2 Plus
Dana\GF10485-PA 153 GF10485-PA 1..135 1..136 306 41.2 Plus
Dana\GF23650-PA 163 GF23650-PA 9..145 8..148 196 31.7 Plus
Dana\GF10800-PA 175 GF10800-PA 12..138 19..147 138 29.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19487-PA 147 GG19487-PA 5..131 11..138 370 52.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14602-PA 149 GH14602-PA 7..145 13..148 209 30.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34283-PA 153 CG34283-PA 1..153 1..153 832 100 Plus
CG32625-PA 144 CG32625-PA 5..141 11..152 297 38 Plus
arx-PA 167 CG3893-PA 4..131 19..147 170 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19179-PA 179 GI19179-PA 34..162 11..139 237 39.2 Plus
Dmoj\GI13489-PA 145 GI13489-PA 6..143 13..150 211 36.1 Plus
Dmoj\GI11828-PA 179 GI11828-PA 10..139 17..148 136 26.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19847-PA 156 GL19847-PA 15..150 14..148 251 37.1 Plus
Dper\GL15775-PA 173 GL15775-PA 10..138 17..147 153 27.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27350-PA 156 GA27350-PA 15..150 14..148 232 35.7 Plus
Dpse\GA26086-PA 173 GA26086-PA 2..138 10..147 157 27.9 Plus
Dpse\GA17756-PA 167 GA17756-PA 2..130 17..147 137 26.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17590-PA 116 GM17590-PA 4..113 31..152 261 43.4 Plus
Dsec\GM16783-PA 73 GM16783-PA 21..72 100..151 155 51.9 Plus
Dsec\GM14914-PA 175 GM14914-PA 10..139 17..147 150 25 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24515-PA 135 GD24515-PA 4..132 10..152 302 42.7 Plus
Dsim\GD23063-PA 144 GD23063-PA 4..143 10..151 257 44.4 Plus
Dsim\GD12322-PA 175 GD12322-PA 10..139 17..147 146 25 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11850-PA 148 GJ11850-PA 6..144 12..148 266 38.6 Plus
Dvir\GJ19312-PA 164 GJ19312-PA 26..163 14..151 266 38.4 Plus
Dvir\GJ20240-PA 173 GJ20240-PA 27..168 11..152 265 38.5 Plus
Dvir\GJ13528-PA 171 GJ13528-PA 2..131 17..148 151 28.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16207-PA 689 GK16207-PA 22..125 17..120 202 35.2 Plus
Dwil\GK22311-PA 122 GK22311-PA 1..96 48..148 184 41.6 Plus
Dwil\GK12727-PA 122 GK12727-PA 1..96 48..148 184 41.6 Plus
Dwil\GK20915-PA 156 GK20915-PA 12..139 19..148 164 25.2 Plus
Dwil\GK22587-PA 128 GK22587-PA 1..84 48..136 148 40.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16140-PA 147 GE16140-PA 5..131 11..138 388 54.7 Plus
Dyak\GE25178-PA 90 GE25178-PA 1..88 64..152 244 52.8 Plus

MIP16764.hyp Sequence

Translation from 68 to 529

> MIP16764.hyp
MSKSNASVEGPRFEEHLVCPFDGLHRILPLDMKTHVLQCAKNFPLEKLVH
CPYNCGQIHSVAEMENHINDCPDRAYLERNNVPSDELPSLAQRPRGVEVE
SEEDWDAEPPSQTYNPSLHCERSMVIRTIHGATRSARREFRKREQKRLND
LNP*

MIP16764.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34283-PA 153 CG34283-PA 1..153 1..153 832 100 Plus
CG32625-PA 144 CG32625-PA 5..141 11..152 297 38 Plus
arx-PA 167 CG3893-PA 4..131 19..147 170 26.2 Plus