Clone MIP16769 Report

Search the DGRC for MIP16769

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:167
Well:69
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42465-RA
Protein status:MIP16769.pep: gold
Sequenced Size:429

Clone Sequence Records

MIP16769.complete Sequence

429 bp assembled on 2010-01-28

GenBank Submission: BT120250.1

> MIP16769.complete
AGTTTTACCTCAGTTTTTTAACGTTGATTCAAAACATACACACATCGAGG
ATGAAAGTATATATTTTGATCTGGACAATATTAGCTCTAACGGCGGATAT
AAATGGCTTGGTTTGTAATCTTGAACCTTTTGTCCAAGGATCATGCCTGG
AATTGACAGACCTCTATTCCTATGTTGAATATAAAAACGATTGTGTATAC
TGGCAGGGATGCCTTCTGAATGGAAATCATTTTAGCAAAAAAGAGGAGTG
CGAAGACATGTGCAAGCAATAACTAACTAGTTAACTATTTTAAGATTTGA
GTATTTTTTCAATCTTGTAGAGCCCTCGTTTTTTGCAAACACATTTTAAG
TATGTTATATCCAGAACTAATTCTATTAGTTGTCGATACTACTAAATGCA
TGAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP16769.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG42465-RA 233 CG42465-RA 1..233 40..272 1165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3699867..3700159 109..401 1450 99.7 Plus
chr2L 23010047 chr2L 3699695..3699803 1..108 465 97.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3700366..3700666 109..409 1490 99.7 Plus
2L 23513712 2L 3700195..3700302 1..108 540 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3700366..3700666 109..409 1490 99.6 Plus
2L 23513712 2L 3700195..3700302 1..108 540 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:09:55 has no hits.

MIP16769.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:10:49 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3699695..3699803 1..108 97 -> Plus
chr2L 3699867..3700159 109..402 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 11:22:34 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 1..222 51..272 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:38 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 1..222 51..272 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:39:23 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 1..222 51..272 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:45:18 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 1..222 51..272 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 11:22:33 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 1..222 51..272 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:38 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 1..222 51..272 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:39:23 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 1..401 1..401 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:18 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
CG42465-RA 1..401 1..401 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:49 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700195..3700302 1..108 100 -> Plus
2L 3700366..3700658 109..402 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:49 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700195..3700302 1..108 100 -> Plus
2L 3700366..3700658 109..402 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:49 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700195..3700302 1..108 100 -> Plus
2L 3700366..3700658 109..402 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:39:23 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3700195..3700302 1..108 100 -> Plus
arm_2L 3700366..3700658 109..402 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:12 Download gff for MIP16769.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700366..3700658 109..402 99   Plus
2L 3700195..3700302 1..108 100 -> Plus

MIP16769.hyp Sequence

Translation from 2 to 271

> MIP16769.hyp
FYLSFLTLIQNIHTSRMKVYILIWTILALTADINGLVCNLEPFVQGSCLE
LTDLYSYVEYKNDCVYWQGCLLNGNHFSKKEECEDMCKQ*

MIP16769.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42465-PA 73 CG42465-PA 1..73 17..89 407 100 Plus

MIP16769.pep Sequence

Translation from 2 to 271

> MIP16769.pep
FYLSFLTLIQNIHTSRMKVYILIWTILALTADINGLVCNLEPFVQGSCLE
LTDLYSYVEYKNDCVYWQGCLLNGNHFSKKEECEDMCKQ*

MIP16769.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14658-PA 110 GF14658-PA 10..78 19..89 129 39.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42465-PA 73 CG42465-PA 1..73 17..89 407 100 Plus