MIP16769.complete Sequence
429 bp assembled on 2010-01-28
GenBank Submission: BT120250.1
> MIP16769.complete
AGTTTTACCTCAGTTTTTTAACGTTGATTCAAAACATACACACATCGAGG
ATGAAAGTATATATTTTGATCTGGACAATATTAGCTCTAACGGCGGATAT
AAATGGCTTGGTTTGTAATCTTGAACCTTTTGTCCAAGGATCATGCCTGG
AATTGACAGACCTCTATTCCTATGTTGAATATAAAAACGATTGTGTATAC
TGGCAGGGATGCCTTCTGAATGGAAATCATTTTAGCAAAAAAGAGGAGTG
CGAAGACATGTGCAAGCAATAACTAACTAGTTAACTATTTTAAGATTTGA
GTATTTTTTCAATCTTGTAGAGCCCTCGTTTTTTGCAAACACATTTTAAG
TATGTTATATCCAGAACTAATTCTATTAGTTGTCGATACTACTAAATGCA
TGAAAAAAAAAAAAAAAAAAAAAAAAAAA
MIP16769.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:40:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42465-RA | 233 | CG42465-RA | 1..233 | 40..272 | 1165 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:09:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 3699867..3700159 | 109..401 | 1450 | 99.7 | Plus |
chr2L | 23010047 | chr2L | 3699695..3699803 | 1..108 | 465 | 97.2 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:09:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3700366..3700666 | 109..409 | 1490 | 99.7 | Plus |
2L | 23513712 | 2L | 3700195..3700302 | 1..108 | 540 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3700366..3700666 | 109..409 | 1490 | 99.6 | Plus |
2L | 23513712 | 2L | 3700195..3700302 | 1..108 | 540 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 21:09:55 has no hits.
MIP16769.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:10:49 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 3699695..3699803 | 1..108 | 97 | -> | Plus |
chr2L | 3699867..3700159 | 109..402 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 11:22:34 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 1..222 | 51..272 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:38 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 1..222 | 51..272 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:39:23 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 1..222 | 51..272 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:45:18 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 1..222 | 51..272 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 11:22:33 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 1..222 | 51..272 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:38 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 1..222 | 51..272 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:39:23 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 1..401 | 1..401 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:45:18 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42465-RA | 1..401 | 1..401 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:49 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700195..3700302 | 1..108 | 100 | -> | Plus |
2L | 3700366..3700658 | 109..402 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:49 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700195..3700302 | 1..108 | 100 | -> | Plus |
2L | 3700366..3700658 | 109..402 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:10:49 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700195..3700302 | 1..108 | 100 | -> | Plus |
2L | 3700366..3700658 | 109..402 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:39:23 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3700195..3700302 | 1..108 | 100 | -> | Plus |
arm_2L | 3700366..3700658 | 109..402 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:12 Download gff for
MIP16769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700366..3700658 | 109..402 | 99 | | Plus |
2L | 3700195..3700302 | 1..108 | 100 | -> | Plus |
MIP16769.hyp Sequence
Translation from 2 to 271
> MIP16769.hyp
FYLSFLTLIQNIHTSRMKVYILIWTILALTADINGLVCNLEPFVQGSCLE
LTDLYSYVEYKNDCVYWQGCLLNGNHFSKKEECEDMCKQ*
MIP16769.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:10:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42465-PA | 73 | CG42465-PA | 1..73 | 17..89 | 407 | 100 | Plus |
MIP16769.pep Sequence
Translation from 2 to 271
> MIP16769.pep
FYLSFLTLIQNIHTSRMKVYILIWTILALTADINGLVCNLEPFVQGSCLE
LTDLYSYVEYKNDCVYWQGCLLNGNHFSKKEECEDMCKQ*
MIP16769.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:54:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14658-PA | 110 | GF14658-PA | 10..78 | 19..89 | 129 | 39.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42465-PA | 73 | CG42465-PA | 1..73 | 17..89 | 407 | 100 | Plus |