Clone MIP16771 Report

Search the DGRC for MIP16771

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:167
Well:71
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42481-RA
Protein status:MIP16771.pep: gold
Sequenced Size:211

Clone Sequence Records

MIP16771.complete Sequence

211 bp assembled on 2010-01-27

GenBank Submission: BT120233.1

> MIP16771.complete
AAAAATGAAGTCGCTGCTGTTTTTTCTGTTGGTCATCCTCTGCCTGGTCG
GAATGGCACCAGCCAGGAGAAAGAAAAGGGAGGTCGAGGTTTGGGTCCGA
CCAAGTCAAAATTCCTATAACGAGCCATGCTACTATCAAGGATGCCAACA
ATGATCATTGGATCCTGAGTGTCAATAAAGGCAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

MIP16771.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42481-RA 228 CG42481-RA 1..187 3..189 905 98.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13289091..13289272 182..1 910 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13298836..13299024 189..1 915 98.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13291936..13292124 189..1 915 98.9 Minus
Blast to na_te.dros performed on 2019-03-16 02:26:46 has no hits.

MIP16771.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:27:25 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13289091..13289272 1..182 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-27 19:48:40 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
CG42481-RA 1..150 5..154 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:04 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
CG42481-RA 1..150 5..154 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:44:49 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
CG42481-RA 1..150 5..154 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:11:05 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
CG42481-RA 1..150 5..154 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-27 19:48:39 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
CG42481-RA 1..180 3..182 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:04 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
CG42481-RA 1..180 3..182 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:44:49 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
CG42481-RA 1..181 2..182 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:11:05 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
CG42481-RA 1..181 2..182 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:25 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13298843..13299024 1..182 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:25 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13298843..13299024 1..182 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:25 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13298843..13299024 1..182 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:44:49 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13291943..13292124 1..182 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:49 Download gff for MIP16771.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13291943..13292124 1..182 100   Minus

MIP16771.hyp Sequence

Translation from 0 to 153

> MIP16771.hyp
KMKSLLFFLLVILCLVGMAPARRKKREVEVWVRPSQNSYNEPCYYQGCQQ
*

MIP16771.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42481-PB 49 CG42481-PB 1..49 2..50 264 100 Plus
CG42481-PA 49 CG42481-PA 1..49 2..50 264 100 Plus

MIP16771.pep Sequence

Translation from 1 to 153

> MIP16771.pep
KMKSLLFFLLVILCLVGMAPARRKKREVEVWVRPSQNSYNEPCYYQGCQQ
*

MIP16771.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG42481-PB 49 CG42481-PB 1..49 2..50 264 100 Plus
CG42481-PA 49 CG42481-PA 1..49 2..50 264 100 Plus