MIP16771.complete Sequence
211 bp assembled on 2010-01-27
GenBank Submission: BT120233.1
> MIP16771.complete
AAAAATGAAGTCGCTGCTGTTTTTTCTGTTGGTCATCCTCTGCCTGGTCG
GAATGGCACCAGCCAGGAGAAAGAAAAGGGAGGTCGAGGTTTGGGTCCGA
CCAAGTCAAAATTCCTATAACGAGCCATGCTACTATCAAGGATGCCAACA
ATGATCATTGGATCCTGAGTGTCAATAAAGGCAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA
MIP16771.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:39:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42481-RA | 228 | CG42481-RA | 1..187 | 3..189 | 905 | 98.9 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:26:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 13289091..13289272 | 182..1 | 910 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:26:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13298836..13299024 | 189..1 | 915 | 98.9 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 13291936..13292124 | 189..1 | 915 | 98.9 | Minus |
Blast to na_te.dros performed on 2019-03-16 02:26:46 has no hits.
MIP16771.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:27:25 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 13289091..13289272 | 1..182 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-27 19:48:40 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42481-RA | 1..150 | 5..154 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:04 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42481-RA | 1..150 | 5..154 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:44:49 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42481-RA | 1..150 | 5..154 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:11:05 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42481-RA | 1..150 | 5..154 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-27 19:48:39 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42481-RA | 1..180 | 3..182 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:04 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42481-RA | 1..180 | 3..182 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:44:49 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42481-RA | 1..181 | 2..182 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:11:05 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42481-RA | 1..181 | 2..182 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:25 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13298843..13299024 | 1..182 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:25 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13298843..13299024 | 1..182 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:25 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13298843..13299024 | 1..182 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:44:49 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13291943..13292124 | 1..182 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:49 Download gff for
MIP16771.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13291943..13292124 | 1..182 | 100 | | Minus |
MIP16771.hyp Sequence
Translation from 0 to 153
> MIP16771.hyp
KMKSLLFFLLVILCLVGMAPARRKKREVEVWVRPSQNSYNEPCYYQGCQQ
*
MIP16771.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:16:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42481-PB | 49 | CG42481-PB | 1..49 | 2..50 | 264 | 100 | Plus |
CG42481-PA | 49 | CG42481-PA | 1..49 | 2..50 | 264 | 100 | Plus |
MIP16771.pep Sequence
Translation from 1 to 153
> MIP16771.pep
KMKSLLFFLLVILCLVGMAPARRKKREVEVWVRPSQNSYNEPCYYQGCQQ
*
MIP16771.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42481-PB | 49 | CG42481-PB | 1..49 | 2..50 | 264 | 100 | Plus |
CG42481-PA | 49 | CG42481-PA | 1..49 | 2..50 | 264 | 100 | Plus |