Clone MIP16808 Report

Search the DGRC for MIP16808

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:168
Well:8
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG12517-RA
Protein status:MIP16808.pep: gold
Sequenced Size:588

Clone Sequence Records

MIP16808.complete Sequence

588 bp assembled on 2010-01-28

GenBank Submission: BT120270.1

> MIP16808.complete
AGTTCAAAACCAAATTTGCTGCAGATCGGACGCAAAGTTTTCAAACGGAC
TTCAAAGGATATATATTCATAAAATGAGTAACCTGGGATCAATACTGCTC
CTTCTGCTCATCATCTGTATCGAACGCTCGCGACAGCAACGCTTCTCGCA
TCCCGAATCCTGGACGGATAATGGGATTTACGTTCCCGGTTCGGAGGACG
ACCTGGACTGGACGGGCGCCAATTGGCAGCTGGTGGTCCGCTTTCTGATG
CAGCGCCAGCAGCTGCGTTTCTGCATCGCACTGGCCAGATTCGATGAGCA
ATTGGTGCCCGGCACAGCCTGCCAGGCTCTTTTGGCCAACGGCCCGCTTA
TGGCCAACTGCGATATTGGCAACATCGAGGATCTGACCATGACCTTGCGC
TATGCCTTCGGCGAAATTCTGCTGGACACAAGTCGAAAATGCCGTCCTGG
CTTGGAGCTATTCGGAGTTCGCTGCAGGCGGAGGGCATAACCTGGGGAAA
GGTTTTATTAAATATTTTAACTTTAATTTTAAAAATACTAGTACAGTTTC
AACAATACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP16808.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG12517-RA 417 CG12517-RA 1..417 74..490 2085 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10868937..10869492 1..556 2645 98.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:20:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10870167..10870722 1..556 2780 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10870167..10870722 1..556 2780 100 Plus
Blast to na_te.dros performed 2019-03-15 18:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 5073..5124 498..549 107 67.3 Plus

MIP16808.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:49:35 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10868937..10869494 1..558 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 10:54:20 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG12517-RA 1..417 74..490 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:32 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG12517-RA 1..417 74..490 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:32:51 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG12517-RA 1..417 74..490 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:10 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG12517-RA 1..417 74..490 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 10:54:19 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG12517-RA 1..417 74..490 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:32 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG12517-RA 1..556 1..556 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:32:51 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG12517-RA 1..556 1..556 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:10 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
CG12517-RA 1..556 1..556 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:35 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10870167..10870724 1..558 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:35 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10870167..10870724 1..558 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:35 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10870167..10870724 1..558 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:32:51 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10870167..10870724 1..558 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:08 Download gff for MIP16808.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10870167..10870724 1..558 99   Plus

MIP16808.hyp Sequence

Translation from 0 to 489

> MIP16808.hyp
VQNQICCRSDAKFSNGLQRIYIHKMSNLGSILLLLLIICIERSRQQRFSH
PESWTDNGIYVPGSEDDLDWTGANWQLVVRFLMQRQQLRFCIALARFDEQ
LVPGTACQALLANGPLMANCDIGNIEDLTMTLRYAFGEILLDTSRKCRPG
LELFGVRCRRRA*

MIP16808.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG12517-PA 138 CG12517-PA 1..138 25..162 728 100 Plus

MIP16808.pep Sequence

Translation from 1 to 489

> MIP16808.pep
VQNQICCRSDAKFSNGLQRIYIHKMSNLGSILLLLLIICIERSRQQRFSH
PESWTDNGIYVPGSEDDLDWTGANWQLVVRFLMQRQQLRFCIALARFDEQ
LVPGTACQALLANGPLMANCDIGNIEDLTMTLRYAFGEILLDTSRKCRPG
LELFGVRCRRRA*

MIP16808.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15831-PA 132 GF15831-PA 6..132 34..162 406 61.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23683-PA 138 GG23683-PA 17..138 41..162 588 91 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10091-PA 138 GH10091-PA 42..138 66..162 312 57.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG12517-PA 138 CG12517-PA 1..138 25..162 728 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14317-PA 139 GI14317-PA 44..139 66..162 269 61.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19124-PA 172 GL19124-PA 1..137 25..159 370 53.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11673-PA 158 GA11673-PA 1..129 25..155 364 55 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18760-PA 138 GM18760-PA 1..138 25..162 655 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23741-PA 132 GD23741-PA 1..132 25..162 663 94.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16247-PA 140 GJ16247-PA 12..140 34..162 317 52.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18927-PA 140 GK18927-PA 27..140 50..162 363 59.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18495-PA 138 GE18495-PA 1..138 25..162 627 91.3 Plus