![]() | BDGP Sequence Production Resources |
Search the DGRC for MIP16808
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 168 |
Well: | 8 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | CG12517-RA |
Protein status: | MIP16808.pep: gold |
Sequenced Size: | 588 |
588 bp assembled on 2010-01-28
GenBank Submission: BT120270.1
> MIP16808.complete AGTTCAAAACCAAATTTGCTGCAGATCGGACGCAAAGTTTTCAAACGGAC TTCAAAGGATATATATTCATAAAATGAGTAACCTGGGATCAATACTGCTC CTTCTGCTCATCATCTGTATCGAACGCTCGCGACAGCAACGCTTCTCGCA TCCCGAATCCTGGACGGATAATGGGATTTACGTTCCCGGTTCGGAGGACG ACCTGGACTGGACGGGCGCCAATTGGCAGCTGGTGGTCCGCTTTCTGATG CAGCGCCAGCAGCTGCGTTTCTGCATCGCACTGGCCAGATTCGATGAGCA ATTGGTGCCCGGCACAGCCTGCCAGGCTCTTTTGGCCAACGGCCCGCTTA TGGCCAACTGCGATATTGGCAACATCGAGGATCTGACCATGACCTTGCGC TATGCCTTCGGCGAAATTCTGCTGGACACAAGTCGAAAATGCCGTCCTGG CTTGGAGCTATTCGGAGTTCGCTGCAGGCGGAGGGCATAACCTGGGGAAA GGTTTTATTAAATATTTTAACTTTAATTTTAAAAATACTAGTACAGTTTC AACAATACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12517-RA | 417 | CG12517-RA | 1..417 | 74..490 | 2085 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 10868937..10869492 | 1..556 | 2645 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10870167..10870722 | 1..556 | 2780 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10870167..10870722 | 1..556 | 2780 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
gypsy4 | 6852 | gypsy4 GYPSY4 6852bp | 5073..5124 | 498..549 | 107 | 67.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 10868937..10869494 | 1..558 | 92 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12517-RA | 1..417 | 74..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12517-RA | 1..417 | 74..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12517-RA | 1..417 | 74..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12517-RA | 1..417 | 74..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12517-RA | 1..417 | 74..490 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12517-RA | 1..556 | 1..556 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12517-RA | 1..556 | 1..556 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12517-RA | 1..556 | 1..556 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10870167..10870724 | 1..558 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10870167..10870724 | 1..558 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10870167..10870724 | 1..558 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 10870167..10870724 | 1..558 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10870167..10870724 | 1..558 | 99 | Plus |
Translation from 0 to 489
> MIP16808.hyp VQNQICCRSDAKFSNGLQRIYIHKMSNLGSILLLLLIICIERSRQQRFSH PESWTDNGIYVPGSEDDLDWTGANWQLVVRFLMQRQQLRFCIALARFDEQ LVPGTACQALLANGPLMANCDIGNIEDLTMTLRYAFGEILLDTSRKCRPG LELFGVRCRRRA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12517-PA | 138 | CG12517-PA | 1..138 | 25..162 | 728 | 100 | Plus |
Translation from 1 to 489
> MIP16808.pep VQNQICCRSDAKFSNGLQRIYIHKMSNLGSILLLLLIICIERSRQQRFSH PESWTDNGIYVPGSEDDLDWTGANWQLVVRFLMQRQQLRFCIALARFDEQ LVPGTACQALLANGPLMANCDIGNIEDLTMTLRYAFGEILLDTSRKCRPG LELFGVRCRRRA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15831-PA | 132 | GF15831-PA | 6..132 | 34..162 | 406 | 61.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23683-PA | 138 | GG23683-PA | 17..138 | 41..162 | 588 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10091-PA | 138 | GH10091-PA | 42..138 | 66..162 | 312 | 57.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12517-PA | 138 | CG12517-PA | 1..138 | 25..162 | 728 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14317-PA | 139 | GI14317-PA | 44..139 | 66..162 | 269 | 61.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19124-PA | 172 | GL19124-PA | 1..137 | 25..159 | 370 | 53.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11673-PA | 158 | GA11673-PA | 1..129 | 25..155 | 364 | 55 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18760-PA | 138 | GM18760-PA | 1..138 | 25..162 | 655 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23741-PA | 132 | GD23741-PA | 1..132 | 25..162 | 663 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16247-PA | 140 | GJ16247-PA | 12..140 | 34..162 | 317 | 52.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18927-PA | 140 | GK18927-PA | 27..140 | 50..162 | 363 | 59.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18495-PA | 138 | GE18495-PA | 1..138 | 25..162 | 627 | 91.3 | Plus |