Clone MIP16817 Report

Search the DGRC for MIP16817

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:168
Well:17
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG13998-RA
Protein status:MIP16817.pep: gold
Sequenced Size:351

Clone Sequence Records

MIP16817.complete Sequence

351 bp assembled on 2011-03-07

GenBank Submission: BT126227.1

> MIP16817.complete
TCTCTTCACAAATGGCTAAGACGATGACGTTCTGGTTTCTGGTCTTGGCT
CTGGTGACCTTAAATCCAACCTGGCCATTCTGGCGCACAGGGGCTGCCGA
AGTCACTTCCGCATCGATGTTCCAGTTTCTGGACCGCCACAATGGTGAAG
GCGACCACAGTTGGTCTCACCTACTGCCCACAAACTTCTACTCCGAGATG
AACCAGCAGTACTACAGGAGATTCCGGCGACAGGCTGGCAGAATGGACAC
CTTCCGATCGGGAAAACGGCAGCAGTACCCTTTTGAATATGCTCGATATG
TCTGATAATAAAAGCAACCCAGAATAACAAAAAAAAAAAAAAAAAAAAAA
A

MIP16817.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5955541..5955867 327..1 1635 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5956490..5956816 327..1 1635 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5956490..5956816 327..1 1635 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:20:07 has no hits.

MIP16817.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:08 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5955540..5955867 1..328 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-09 09:22:36 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
CG13998-RA 1..294 12..305 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:41 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
CG13998-RA 1..294 12..305 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:27:05 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
CG13998-RA 1..294 12..305 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:22:36 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
CG13998-RA 1..294 12..305 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:41 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
CG13998-RA 4..330 1..328 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:27:05 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
CG13998-RA 4..330 1..328 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:08 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5956489..5956816 1..328 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:08 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5956489..5956816 1..328 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:08 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5956489..5956816 1..328 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:41 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5956489..5956816 1..328 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:47 Download gff for MIP16817.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5956489..5956816 1..328 99   Minus

MIP16817.hyp Sequence

Translation from 2 to 304

> MIP16817.hyp
SSQMAKTMTFWFLVLALVTLNPTWPFWRTGAAEVTSASMFQFLDRHNGEG
DHSWSHLLPTNFYSEMNQQYYRRFRRQAGRMDTFRSGKRQQYPFEYARYV
*

MIP16817.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13998-PA 97 CG13998-PA 1..97 4..100 535 100 Plus

MIP16817.pep Sequence

Translation from 2 to 304

> MIP16817.pep
SSQMAKTMTFWFLVLALVTLNPTWPFWRTGAAEVTSASMFQFLDRHNGEG
DHSWSHLLPTNFYSEMNQQYYRRFRRQAGRMDTFRSGKRQQYPFEYARYV
*

MIP16817.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19669-PA 87 GF19669-PA 2..85 8..100 275 63.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24271-PA 97 GG24271-PA 1..97 4..100 473 89.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10722-PA 63 GH10722-PA 1..63 39..100 167 55.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13998-PA 97 CG13998-PA 1..97 4..100 535 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11349-PA 95 GI11349-PA 33..95 35..100 143 45.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19101-PA 87 GL19101-PA 1..87 8..100 181 51.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12687-PA 87 GA12687-PA 1..87 8..100 186 52.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17985-PA 97 GM17985-PA 1..97 4..100 474 91.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22622-PA 97 GD22622-PA 1..97 4..100 484 93.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12613-PA 99 GJ12613-PA 31..97 35..100 151 46.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19063-PA 90 GK19063-PA 1..89 4..99 165 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18968-PA 97 GE18968-PA 1..97 4..100 471 89.7 Plus