MIP16862.complete Sequence
300 bp assembled on 2010-01-28
GenBank Submission: BT120272.1
> MIP16862.complete
GAGTTCGAAGTCAAGATCAGCGAAGATGATTGCCACAACGGTGTGTTTCT
ACTTGGTGGTCTTGGCCATTCTCATGGCCTTCCTGTCTCCCACAGCAGAT
GGTTGCTTCATCCTGCTTGCGTGCCTGTTGAAGTCACCCCTCTGTCCGTT
CAACACCACATCATCTGGATGATAGAGTGCATTTTTTTGTTGCCCCTTGC
CGCGCCCGATAAATACGACTATGCATTAAAAAATATATTTACTAAAATAT
AACTAACTTTTCAATTTCGTTGACAAAAAAAAAAAAAAAAAAAAAAAAAA
MIP16862.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:40:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34212-RA | 147 | CG34212-RA | 1..147 | 26..172 | 735 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:27:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 1937013..1937286 | 274..1 | 1355 | 99.6 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:21:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:27:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 6049868..6050147 | 280..1 | 1400 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 6051067..6051346 | 280..1 | 1400 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 23:27:34 has no hits.
MIP16862.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:28:20 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 1937013..1937286 | 1..274 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 17:24:09 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RA | 1..147 | 26..172 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:14:18 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RA | 1..147 | 26..172 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:30 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RB | 1..147 | 26..172 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:35:29 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RB | 1..147 | 26..172 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 17:24:08 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RA | 1..147 | 26..172 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:14:17 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RB | 85..325 | 1..241 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:30 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RB | 85..358 | 1..274 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:35:29 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RB | 85..358 | 1..274 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:20 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6049874..6050147 | 1..274 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:20 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6049874..6050147 | 1..274 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:20 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6049874..6050147 | 1..274 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:30 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 1937379..1937652 | 1..274 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:39 Download gff for
MIP16862.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6051073..6051346 | 1..274 | 100 | | Minus |
MIP16862.hyp Sequence
Translation from 0 to 251
> MIP16862.hyp
EFEVKISEDDCHNGVFLLGGLGHSHGLPVSHSRWLLHPACVPVEVTPLSV
QHHIIWMIECIFLLPLAAPDKYDYALKNIFTKI*
Sequence MIP16862.hyp has no blast hits.
MIP16862.pep Sequence
Translation from 1 to 171
> MIP16862.pep
SSKSRSAKMIATTVCFYLVVLAILMAFLSPTADGCFILLACLLKSPLCPF
NTTSSG*
MIP16862.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34212-PA | 48 | CG34212-PA | 1..48 | 9..56 | 248 | 100 | Plus |
CG34212-PB | 48 | CG34212-PB | 1..48 | 9..56 | 248 | 100 | Plus |