Clone MIP16862 Report

Search the DGRC for MIP16862

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:168
Well:62
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34212-RA
Protein status:MIP16862.pep: gold
Sequenced Size:300

Clone Sequence Records

MIP16862.complete Sequence

300 bp assembled on 2010-01-28

GenBank Submission: BT120272.1

> MIP16862.complete
GAGTTCGAAGTCAAGATCAGCGAAGATGATTGCCACAACGGTGTGTTTCT
ACTTGGTGGTCTTGGCCATTCTCATGGCCTTCCTGTCTCCCACAGCAGAT
GGTTGCTTCATCCTGCTTGCGTGCCTGTTGAAGTCACCCCTCTGTCCGTT
CAACACCACATCATCTGGATGATAGAGTGCATTTTTTTGTTGCCCCTTGC
CGCGCCCGATAAATACGACTATGCATTAAAAAATATATTTACTAAAATAT
AACTAACTTTTCAATTTCGTTGACAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP16862.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34212-RA 147 CG34212-RA 1..147 26..172 735 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1937013..1937286 274..1 1355 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:21:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6049868..6050147 280..1 1400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6051067..6051346 280..1 1400 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:27:34 has no hits.

MIP16862.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:28:20 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1937013..1937286 1..274 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 17:24:09 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RA 1..147 26..172 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:14:18 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RA 1..147 26..172 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:30 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RB 1..147 26..172 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:35:29 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RB 1..147 26..172 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 17:24:08 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RA 1..147 26..172 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:14:17 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RB 85..325 1..241 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:30 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RB 85..358 1..274 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:35:29 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RB 85..358 1..274 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:20 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6049874..6050147 1..274 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:20 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6049874..6050147 1..274 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:28:20 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6049874..6050147 1..274 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:30 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1937379..1937652 1..274 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:39 Download gff for MIP16862.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6051073..6051346 1..274 100   Minus

MIP16862.hyp Sequence

Translation from 0 to 251

> MIP16862.hyp
EFEVKISEDDCHNGVFLLGGLGHSHGLPVSHSRWLLHPACVPVEVTPLSV
QHHIIWMIECIFLLPLAAPDKYDYALKNIFTKI*
Sequence MIP16862.hyp has no blast hits.

MIP16862.pep Sequence

Translation from 1 to 171

> MIP16862.pep
SSKSRSAKMIATTVCFYLVVLAILMAFLSPTADGCFILLACLLKSPLCPF
NTTSSG*

MIP16862.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG34212-PA 48 CG34212-PA 1..48 9..56 248 100 Plus
CG34212-PB 48 CG34212-PB 1..48 9..56 248 100 Plus