Clone MIP16867 Report

Search the DGRC for MIP16867

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:168
Well:67
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42302-RA
Protein status:MIP16867.pep: gold
Sequenced Size:795

Clone Sequence Records

MIP16867.complete Sequence

795 bp assembled on 2010-01-28

GenBank Submission: BT120248.1

> MIP16867.complete
TCCCAAACTTCCAACTGTGAATTCCGCATTTATTAGTCCCTATCCCCGTG
ACCGAGCCCCATAATCGCTTGTCAAATGGCCACGAACCAGCACGACCTCG
AGCGGATTCGCCAGCAGATCGTGTTGGCCAACATTCAGGAGCTGATAAAG
AAGATGACACGTCGCTGCTTCGACGTATGTATCGCTATGCCGGAAATGGA
GTTGCGCTCCACGGAGCGCGACTGCCTGGCCAACTGTATGGATCGATTCA
TGGACTCGGTTCAGGTGGTGTCGAGCCAGTACTTCCGTCGCCGGCGTCGC
CATCAGCAAATTCGTTTGTCCCGTTCGACCGCCTCCTCCGCATCACCACC
AGCATCCGCATCCGCATCCATGCCCAAATCCGCAGCAGCAAATGAATCTG
AATCCGCATCTAGGGCCTCCAATGACGAAAAGGTCAAATAATGGTTAAGT
CTAGACAGATAGCCACGTGTGGAGTTTATTCCAAGTCGAAAACGAAGGCT
GTTCCGTCGTAGCCCCAGATCCCCAGTGTACTTGGGTGATGGCCACTTGT
CCACATTGGTCATCATCCCAAAGCTTTCGAGGATGATTTCATACTTCGAG
ACCTTTGGGAAGGGCAAGAAGGGGTCGTCTAGCTGGAAATGAAAGTGGAT
TTTCTGCAGGCGTGGCCATCGATGATTTCTTGCTATTGGTTCTTAACAAA
ATCCTAGTAGAGTCTTAAGTAAATGACGATTGGCAGAAAATAAAGATGTC
GTTCAGTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP16867.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG42302-RA 366 CG42302-RA 1..366 76..441 1830 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18614051..18614807 757..1 3650 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:21:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18724913..18725672 760..1 3800 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18733011..18733770 760..1 3800 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:51:15 has no hits.

MIP16867.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:52:15 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18614049..18614807 1..759 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-28 11:08:31 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..366 76..441 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:13:34 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..366 76..441 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:04:12 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..366 76..441 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:34:05 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..366 76..441 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-28 11:08:31 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..366 76..441 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:13:34 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..366 76..441 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:04:12 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..366 76..441 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:34:05 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
CG42302-RA 1..759 1..759 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:52:15 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
X 18724914..18725672 1..759 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:52:15 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
X 18724914..18725672 1..759 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:52:15 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
X 18724914..18725672 1..759 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:04:12 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18618947..18619705 1..759 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:10 Download gff for MIP16867.complete
Subject Subject Range Query Range Percent Splice Strand
X 18733012..18733770 1..759 100   Minus

MIP16867.hyp Sequence

Translation from 75 to 440

> MIP16867.hyp
MATNQHDLERIRQQIVLANIQELIKKMTRRCFDVCIAMPEMELRSTERDC
LANCMDRFMDSVQVVSSQYFRRRRRHQQIRLSRSTASSASPPASASASMP
KSAAANESESASRASNDEKVK*

MIP16867.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG42302-PA 121 CG42302-PA 1..121 1..121 602 100 Plus
Tim13-PA 92 CG11611-PA 12..81 8..77 185 48.6 Plus
CG34132-PA 84 CG34132-PA 12..81 8..77 175 44.3 Plus

MIP16867.pep Sequence

Translation from 75 to 440

> MIP16867.pep
MATNQHDLERIRQQIVLANIQELIKKMTRRCFDVCIAMPEMELRSTERDC
LANCMDRFMDSVQVVSSQYFRRRRRHQQIRLSRSTASSASPPASASASMP
KSAAANESESASRASNDEKVK*

MIP16867.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24514-PA 92 GF24514-PA 12..81 8..77 183 47.1 Plus
Dana\GF21863-PA 84 GF21863-PA 12..81 8..77 182 44.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13890-PA 93 GG13890-PA 12..81 8..77 185 47.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16382-PA 92 GH16382-PA 8..81 4..77 176 43.2 Plus
Dgri\GH10210-PA 82 GH10210-PA 10..79 8..77 170 41.4 Plus
Dgri\GH11842-PA 85 GH11842-PA 11..80 8..77 154 38.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG42302-PA 121 CG42302-PA 1..121 1..121 602 100 Plus
Tim13-PA 92 CG11611-PA 12..81 8..77 185 48.6 Plus
CG34132-PA 84 CG34132-PA 12..81 8..77 175 44.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11575-PA 91 GI11575-PA 8..81 4..77 178 44.6 Plus
Dmoj\GI14974-PA 84 GI14974-PA 12..81 8..77 176 42.9 Plus
Dmoj\GI14992-PA 83 GI14992-PA 13..81 8..76 162 49.3 Plus
Dmoj\GI14322-PA 87 GI14322-PA 13..80 8..75 158 41.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:53:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20826-PA 92 GL20826-PA 8..81 2..75 182 45.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:53:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11098-PA 92 GA11098-PA 8..81 2..75 182 45.9 Plus
Dpse\GA25739-PA 94 GA25739-PA 12..92 8..78 167 39.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24714-PA 93 GM24714-PA 12..81 8..77 188 48.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12777-PA 93 GD12777-PA 12..81 8..77 188 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17233-PA 83 GJ17233-PA 11..80 8..77 177 44.3 Plus
Dvir\GJ11254-PA 92 GJ11254-PA 12..79 8..75 173 45.6 Plus
Dvir\GJ15348-PA 68 GJ15348-PA 1..68 11..78 159 50 Plus
Dvir\GJ19379-PA 87 GJ19379-PA 13..80 8..75 157 39.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11560-PA 120 GK11560-PA 12..79 8..75 178 42.6 Plus
Dwil\GK10163-PA 87 GK10163-PA 9..84 5..80 176 42.1 Plus
Dwil\GK12379-PA 720 GK12379-PA 5..120 3..118 156 29.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15496-PA 125 GE15496-PA 1..125 1..121 486 80.8 Plus
Dyak\GE20181-PA 93 GE20181-PA 12..81 8..77 181 45.7 Plus