Clone MIP17133 Report

Search the DGRC for MIP17133

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:171
Well:33
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG5767-RA
Protein status:MIP17133.pep: gold
Sequenced Size:886

Clone Sequence Records

MIP17133.complete Sequence

886 bp assembled on 2011-09-19

GenBank Submission: BT128908.1

> MIP17133.complete
AGCGACAGTAAAGATCGAGCCGCCAACAAAACGACCGCCAACATGAAGCT
TCTGTGCAGTGTGCTAATCCTCGCCAGCGTTCTGGCGGCCAACGCCAAGC
CCAATGTTCAGCTGCAGCTGCAGAGTGCCCTCGACCAGTATTTGGTGCAT
GCCCGCAATTTGGATACCACCGTTTCCGCTGACGTGACCACCCAGTGCTT
CAACCTCTATCTGCCCATGCTGAACGAAGTGGCTGCCACCTTCTCCACTT
CCTATCAGGCCTGCATCAGCACCGCCAACGCGGAGACCGCCAATCTGACC
GCCGAGGCCGACAAGCAGCAGAAGATCTACCAGGCGGAGGTCACCAGCCT
ATGCAGCGCCTTCACCGCCTGCAACAGCGACAACGATACCACCAACTTCT
TCAAGTGCTACGCCAATGCGGCCGAGAGTGATGTATCTGTGATCTATGGC
ATCGCCACCAATGCCGCCAGTTCGGCCAACTCCCTGAGCACAGGCATCCA
GGCCATCCAGGACACCGAGTACCAGTGCACCAACACCACGGAGAGCAACT
ACGTCCGGGATACCGCTGCCACCTACGATCTGTTGGACAGCTGCCTGAAG
TACGGAGTGCCCACCACCTCCACCGCCGCCCCCTCCTCCACCAGCCCCGT
TGATAGCTCGAGCGGGGCTCCTGTCACTGATGGCACCACTGTTGTGGCAT
CGTCCACCGCCGCTGCTGACACCACTGTGGCTGTGACCACCGCTGCACCC
GGAACCGCTGCTCCGGCGACCACCGCCACTTCCGGCACTTCGGCCTCTTC
TTAAGTCACAACTTTAAGTAATCACAAGCAATAAATGAACATTTGAAAAA
AACGTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP17133.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13933508..13933939 851..420 2085 98.8 Minus
chr2R 21145070 chr2R 13934119..13934446 421..94 1565 98.5 Minus
chr2R 21145070 chr2R 13931770..13932059 413..124 655 81.7 Minus
chr2R 21145070 chr2R 13931503..13931691 617..429 540 85.7 Minus
chr2R 21145070 chr2R 13934510..13934603 94..1 470 100 Minus
chr2R 21145070 chr2R 13932138..13932198 94..34 200 88.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18046389..18046820 851..420 2160 100 Minus
2R 25286936 2R 18047000..18047327 421..94 1625 99.7 Minus
2R 25286936 2R 18044621..18044919 419..121 655 81.3 Minus
2R 25286936 2R 18044360..18044548 617..429 540 85.7 Minus
2R 25286936 2R 18047391..18047484 94..1 470 100 Minus
2R 25286936 2R 18044995..18045055 94..34 185 86.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18047588..18048019 851..420 2160 100 Minus
2R 25260384 2R 18048199..18048526 421..94 1625 99.6 Minus
2R 25260384 2R 18045820..18046118 419..121 655 81.2 Minus
2R 25260384 2R 18045559..18045747 617..429 540 85.7 Minus
2R 25260384 2R 18048590..18048683 94..1 470 100 Minus
2R 25260384 2R 18046194..18046254 94..34 185 86.8 Minus
Blast to na_te.dros performed 2019-03-15 11:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
transib4 2656 transib4 TRANSIB4 2656bp 337..392 852..798 115 69.6 Minus

MIP17133.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:02:53 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13933504..13933938 421..856 98 <- Minus
chr2R 13934120..13934446 94..420 98 <- Minus
chr2R 13934511..13934603 1..93 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-09-19 13:15:22 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
CG5767-RA 1..762 43..804 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:34:28 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
CG5767-RA 1..762 43..804 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:20:39 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
CG5767-RA 1..762 43..804 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-19 13:15:22 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
CG5767-RA 1..842 1..842 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:34:28 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
CG5767-RA 1..854 1..855 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:20:39 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
CG5767-RA 1..854 1..855 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:53 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18046385..18046819 421..856 99 <- Minus
2R 18047001..18047327 94..420 99 <- Minus
2R 18047392..18047484 1..93 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:53 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18046385..18046819 421..856 99 <- Minus
2R 18047001..18047327 94..420 99 <- Minus
2R 18047392..18047484 1..93 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:02:53 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18046385..18046819 421..856 99 <- Minus
2R 18047001..18047327 94..420 99 <- Minus
2R 18047392..18047484 1..93 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:34:28 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13933890..13934324 421..856 99 <- Minus
arm_2R 13934506..13934832 94..420 99 <- Minus
arm_2R 13934897..13934989 1..93 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:49:01 Download gff for MIP17133.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18047584..18048018 421..856 99 <- Minus
2R 18048200..18048526 94..420 99 <- Minus
2R 18048591..18048683 1..93 100   Minus

MIP17133.hyp Sequence

Translation from 0 to 803

> MIP17133.hyp
SDSKDRAANKTTANMKLLCSVLILASVLAANAKPNVQLQLQSALDQYLVH
ARNLDTTVSADVTTQCFNLYLPMLNEVAATFSTSYQACISTANAETANLT
AEADKQQKIYQAEVTSLCSAFTACNSDNDTTNFFKCYANAAESDVSVIYG
IATNAASSANSLSTGIQAIQDTEYQCTNTTESNYVRDTAATYDLLDSCLK
YGVPTTSTAAPSSTSPVDSSSGAPVTDGTTVVASSTAAADTTVAVTTAAP
GTAAPATTATSGTSASS*

MIP17133.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG5767-PA 253 CG5767-PA 1..253 15..267 1259 100 Plus
CG5770-PA 213 CG5770-PA 1..206 15..218 800 75 Plus
CG10911-PA 359 CG10911-PA 5..256 18..267 287 26.7 Plus
Muc55B-PB 485 CG5765-PB 6..256 17..258 242 29.7 Plus
Muc55B-PA 485 CG5765-PA 6..256 17..258 242 29.7 Plus

MIP17133.pep Sequence

Translation from 0 to 803

> MIP17133.pep
SDSKDRAANKTTANMKLLCSVLILASVLAANAKPNVQLQLQSALDQYLVH
ARNLDTTVSADVTTQCFNLYLPMLNEVAATFSTSYQACISTANAETANLT
AEADKQQKIYQAEVTSLCSAFTACNSDNDTTNFFKCYANAAESDVSVIYG
IATNAASSANSLSTGIQAIQDTEYQCTNTTESNYVRDTAATYDLLDSCLK
YGVPTTSTAAPSSTSPVDSSSGAPVTDGTTVVASSTAAADTTVAVTTAAP
GTAAPATTATSGTSASS*

MIP17133.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13211-PA 249 GF13211-PA 1..249 15..266 842 71.8 Plus
Dana\GF13208-PA 377 GF13208-PA 5..249 18..256 266 31.9 Plus
Dana\GF22881-PA 228 GF22881-PA 60..197 66..204 192 29.5 Plus
Dana\GF11688-PA 135 GF11688-PA 1..130 71..200 158 27.7 Plus
Dana\GF23352-PA 223 GF23352-PA 13..203 18..208 153 29.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21000-PA 300 GG21000-PA 1..277 15..259 945 78.3 Plus
Dere\GG21002-PA 211 GG21002-PA 1..206 15..222 739 72.6 Plus
Dere\GG20997-PA 383 GG20997-PA 32..195 44..215 217 30.2 Plus
Dere\GG21837-PA 184 GG21837-PA 6..179 21..200 195 31.1 Plus
Dere\GG12013-PA 233 GG12013-PA 17..203 22..207 187 32.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20454-PA 246 GH20454-PA 1..203 15..215 687 68.8 Plus
Dgri\GH20448-PA 278 GH20448-PA 5..190 18..207 210 26.3 Plus
Dgri\GH21443-PA 174 GH21443-PA 27..164 63..200 206 33.3 Plus
Dgri\GH20449-PA 205 GH20449-PA 6..190 20..213 178 27.3 Plus
Dgri\GH20451-PA 184 GH20451-PA 15..179 59..221 176 26.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG5767-PA 253 CG5767-PA 1..253 15..267 1259 100 Plus
CG5770-PA 213 CG5770-PA 1..206 15..218 800 75 Plus
CG10911-PA 359 CG10911-PA 5..256 18..267 287 26.7 Plus
Muc55B-PB 485 CG5765-PB 6..256 17..258 242 29.7 Plus
Muc55B-PA 485 CG5765-PA 6..256 17..258 242 29.7 Plus
CG16762-PA 254 CG16762-PA 6..239 13..250 231 26.5 Plus
CG34005-PC 185 CG34005-PC 1..180 15..200 223 30.6 Plus
CG34005-PB 185 CG34005-PB 1..180 15..200 223 30.6 Plus
CG11470-PB 230 CG11470-PB 10..227 21..250 221 28.6 Plus
CG11470-PA 230 CG11470-PA 10..227 21..250 221 28.6 Plus
CG10912-PA 271 CG10912-PA 48..255 62..266 183 23 Plus
CG7567-PA 211 CG7567-PA 57..204 63..209 173 25.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19281-PA 230 GI19281-PA 1..226 15..242 712 65.5 Plus
Dmoj\GI20246-PA 186 GI20246-PA 26..180 42..200 216 31.9 Plus
Dmoj\GI19278-PA 253 GI19278-PA 49..196 66..214 205 30.2 Plus
Dmoj\GI12536-PA 253 GI12536-PA 9..235 21..258 183 27.8 Plus
Dmoj\GI24461-PA 231 GI24461-PA 1..205 15..214 174 28 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10543-PA 256 GL10543-PA 1..243 15..254 864 74.1 Plus
Dper\GL11526-PA 186 GL11526-PA 44..181 63..200 197 31.9 Plus
Dper\GL10541-PA 318 GL10541-PA 53..280 62..261 179 27.6 Plus
Dper\GL24611-PA 258 GL24611-PA 35..198 34..199 176 26.5 Plus
Dper\GL13587-PA 220 GL13587-PA 50..213 63..230 175 28.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19113-PA 256 GA19113-PA 1..241 15..252 852 73.9 Plus
Dpse\GA24760-PA 186 GA24760-PA 44..181 63..200 195 31.9 Plus
Dpse\GA24403-PA 372 GA24403-PA 57..280 66..261 183 28.9 Plus
Dpse\GA14134-PA 258 GA14134-PA 35..198 34..199 176 26.5 Plus
Dpse\GA26834-PA 218 GA26834-PA 50..215 63..225 169 26.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19934-PA 253 GM19934-PA 1..253 15..267 1232 96.4 Plus
Dsec\GM19935-PA 212 GM19935-PA 1..202 15..215 739 75 Plus
Dsec\GM19931-PA 366 GM19931-PA 5..192 18..207 205 28.8 Plus
Dsec\GM21839-PA 189 GM21839-PA 34..184 47..199 195 32 Plus
Dsec\GM12238-PA 236 GM12238-PA 10..216 21..222 185 30.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:01:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25423-PA 253 GD25423-PA 1..253 15..267 1242 97.2 Plus
Dsim\GD25424-PA 212 GD25424-PA 1..202 15..215 793 74.5 Plus
Dsim\GD25420-PA 381 GD25420-PA 5..192 18..207 213 28.3 Plus
Dsim\GD25421-PA 412 GD25421-PA 56..265 66..264 200 29 Plus
Dsim\GD11333-PA 190 GD11333-PA 40..185 55..200 198 32.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 23:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22158-PA 248 GJ22158-PA 1..221 15..226 695 69.8 Plus
Dvir\GJ22155-PA 276 GJ22155-PA 1..266 15..258 274 29.5 Plus
Dvir\GJ20200-PA 187 GJ20200-PA 40..177 63..200 206 31.2 Plus
Dvir\GJ16053-PA 252 GJ16053-PA 9..192 21..199 185 28 Plus
Dvir\GJ22156-PA 372 GJ22156-PA 25..252 31..256 185 25.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22063-PA 185 GK22063-PA 1..184 73..261 555 72 Plus
Dwil\GK22059-PA 340 GK22059-PA 5..179 18..200 220 28.4 Plus
Dwil\GK22242-PA 168 GK22242-PA 18..162 56..200 201 31 Plus
Dwil\GK12510-PA 326 GK12510-PA 10..187 20..199 172 26.1 Plus
Dwil\GK11180-PA 229 GK11180-PA 56..207 61..212 152 27.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13943-PA 274 GE13943-PA 1..238 15..252 1039 92.9 Plus
Dyak\GE13945-PA 211 GE13945-PA 1..187 15..203 707 76.7 Plus
Dyak\GE13940-PA 406 GE13940-PA 5..189 18..204 231 28.7 Plus
Dyak\GE11916-PA 184 GE11916-PA 42..179 63..200 197 32.6 Plus
Dyak\GE10449-PA 225 GE10449-PA 8..199 23..203 184 33 Plus