MIP19001.complete Sequence
331 bp assembled on 2010-03-23
GenBank Submission: BT122102.1
> MIP19001.complete
TACAGCCAGACAATGTTCAATATAAAGTTAATCATCCTGGTTGCCCTGAC
CATCTCCATGGTCCAGAGCTGTTCCGTTGAGGAGCCGGAACAGGTCGAGT
GCGGGTGTGGGTGTGGCAAGCCGCAGTGCCTCTCTTGCGGATCCAGATCC
TGCGGATGTGGCTGCAACCCCTGTCGATGTCCTTCCTCTTCCGGGTGTGG
CTGCAAGGATTAATCCAGGACTCCAGGACCCCTTCAGAACTTTGCCTTCA
CAAAACCTTCGTTTTTCAAATTATTTGTTTTTCCTTTTCATTAAAGTACT
GATACATTTTGCAAAAAAAAAAAAAAAAAAA
MIP19001.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:37:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7606-RB | 580 | CG7606-RB | 101..415 | 1..315 | 1575 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:46:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 13420887..13421113 | 1..227 | 1120 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 13421165..13421253 | 224..312 | 445 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:21:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17596551..17596777 | 1..227 | 1135 | 100 | Plus |
3R | 32079331 | 3R | 17596829..17596920 | 224..315 | 460 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 17337382..17337608 | 1..227 | 1135 | 100 | Plus |
3R | 31820162 | 3R | 17337660..17337751 | 224..315 | 460 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 18:46:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Stalker | 7256 | Stalker STALKER 7256bp | 1320..1390 | 239..308 | 109 | 65.3 | Plus |
FB | 1106 | FB DMTNFB 1106bp AKA(J01084) Derived from V00246 (g8708) (Rel. 36, Last updated, Version 3). | 162..195 | 251..282 | 102 | 82.4 | Plus |
412 | 7567 | 412 412 7567bp | 6779..6828 | 310..263 | 101 | 70 | Minus |
MIP19001.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:47:47 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 13421168..13421253 | 227..312 | 100 | | Plus |
chr3R | 13420887..13421112 | 1..226 | 99 | -> | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:56:53 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7606-RB | 1..201 | 13..213 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:51:07 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7606-RB | 1..201 | 13..213 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:50:34 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7606-RB | 1..201 | 13..213 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:56:53 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7606-RB | 16..327 | 1..312 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:07 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7606-RB | 16..327 | 1..312 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:50:34 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG7606-RB | 16..327 | 1..312 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:47 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17596551..17596776 | 1..226 | 100 | -> | Plus |
3R | 17596832..17596917 | 227..312 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:47 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17596551..17596776 | 1..226 | 100 | -> | Plus |
3R | 17596832..17596917 | 227..312 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:47 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17596551..17596776 | 1..226 | 100 | -> | Plus |
3R | 17596832..17596917 | 227..312 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:07 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 13422273..13422498 | 1..226 | 100 | -> | Plus |
arm_3R | 13422554..13422639 | 227..312 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:33:38 Download gff for
MIP19001.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17337382..17337607 | 1..226 | 100 | -> | Plus |
3R | 17337663..17337748 | 227..312 | 100 | | Plus |
MIP19001.hyp Sequence
Translation from 0 to 212
> MIP19001.hyp
YSQTMFNIKLIILVALTISMVQSCSVEEPEQVECGCGCGKPQCLSCGSRS
CGCGCNPCRCPSSSGCGCKD*
MIP19001.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:11:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7606-PC | 66 | CG7606-PC | 1..66 | 5..70 | 380 | 100 | Plus |
CG7606-PB | 66 | CG7606-PB | 1..66 | 5..70 | 380 | 100 | Plus |
MIP19001.pep Sequence
Translation from 0 to 212
> MIP19001.pep
YSQTMFNIKLIILVALTISMVQSCSVEEPEQVECGCGCGKPQCLSCGSRS
CGCGCNPCRCPSSSGCGCKD*
MIP19001.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG7606-PC | 66 | CG7606-PC | 1..66 | 5..70 | 380 | 100 | Plus |
CG7606-PB | 66 | CG7606-PB | 1..66 | 5..70 | 380 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:22:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL13781-PA | 71 | GL13781-PA | 1..71 | 5..70 | 145 | 53.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:22:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA26790-PA | 71 | GA26790-PA | 1..71 | 5..70 | 139 | 52.1 | Plus |