Clone MIP19001 Report

Search the DGRC for MIP19001

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:190
Well:1
Vector:pOT2
Associated Gene/TranscriptCG7606-RB
Protein status:MIP19001.pep: gold
Sequenced Size:331

Clone Sequence Records

MIP19001.complete Sequence

331 bp assembled on 2010-03-23

GenBank Submission: BT122102.1

> MIP19001.complete
TACAGCCAGACAATGTTCAATATAAAGTTAATCATCCTGGTTGCCCTGAC
CATCTCCATGGTCCAGAGCTGTTCCGTTGAGGAGCCGGAACAGGTCGAGT
GCGGGTGTGGGTGTGGCAAGCCGCAGTGCCTCTCTTGCGGATCCAGATCC
TGCGGATGTGGCTGCAACCCCTGTCGATGTCCTTCCTCTTCCGGGTGTGG
CTGCAAGGATTAATCCAGGACTCCAGGACCCCTTCAGAACTTTGCCTTCA
CAAAACCTTCGTTTTTCAAATTATTTGTTTTTCCTTTTCATTAAAGTACT
GATACATTTTGCAAAAAAAAAAAAAAAAAAA

MIP19001.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG7606-RB 580 CG7606-RB 101..415 1..315 1575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13420887..13421113 1..227 1120 99.6 Plus
chr3R 27901430 chr3R 13421165..13421253 224..312 445 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:21:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17596551..17596777 1..227 1135 100 Plus
3R 32079331 3R 17596829..17596920 224..315 460 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17337382..17337608 1..227 1135 100 Plus
3R 31820162 3R 17337660..17337751 224..315 460 100 Plus
Blast to na_te.dros performed 2019-03-16 18:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker 7256 Stalker STALKER 7256bp 1320..1390 239..308 109 65.3 Plus
FB 1106 FB DMTNFB 1106bp AKA(J01084) Derived from V00246 (g8708) (Rel. 36, Last updated, Version 3). 162..195 251..282 102 82.4 Plus
412 7567 412 412 7567bp 6779..6828 310..263 101 70 Minus

MIP19001.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:47:47 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13421168..13421253 227..312 100   Plus
chr3R 13420887..13421112 1..226 99 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:56:53 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
CG7606-RB 1..201 13..213 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:51:07 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
CG7606-RB 1..201 13..213 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:50:34 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
CG7606-RB 1..201 13..213 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:56:53 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
CG7606-RB 16..327 1..312 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:07 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
CG7606-RB 16..327 1..312 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:50:34 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
CG7606-RB 16..327 1..312 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:47 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17596551..17596776 1..226 100 -> Plus
3R 17596832..17596917 227..312 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:47 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17596551..17596776 1..226 100 -> Plus
3R 17596832..17596917 227..312 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:47:47 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17596551..17596776 1..226 100 -> Plus
3R 17596832..17596917 227..312 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:07 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13422273..13422498 1..226 100 -> Plus
arm_3R 13422554..13422639 227..312 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:33:38 Download gff for MIP19001.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17337382..17337607 1..226 100 -> Plus
3R 17337663..17337748 227..312 100   Plus

MIP19001.hyp Sequence

Translation from 0 to 212

> MIP19001.hyp
YSQTMFNIKLIILVALTISMVQSCSVEEPEQVECGCGCGKPQCLSCGSRS
CGCGCNPCRCPSSSGCGCKD*

MIP19001.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG7606-PC 66 CG7606-PC 1..66 5..70 380 100 Plus
CG7606-PB 66 CG7606-PB 1..66 5..70 380 100 Plus

MIP19001.pep Sequence

Translation from 0 to 212

> MIP19001.pep
YSQTMFNIKLIILVALTISMVQSCSVEEPEQVECGCGCGKPQCLSCGSRS
CGCGCNPCRCPSSSGCGCKD*

MIP19001.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG7606-PC 66 CG7606-PC 1..66 5..70 380 100 Plus
CG7606-PB 66 CG7606-PB 1..66 5..70 380 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13781-PA 71 GL13781-PA 1..71 5..70 145 53.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26790-PA 71 GA26790-PA 1..71 5..70 139 52.1 Plus