Clone MIP19202 Report

Search the DGRC for MIP19202

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:192
Well:2
Vector:pOT2
Associated Gene/TranscriptCG42717-RA
Protein status:MIP19202.pep: gold
Sequenced Size:391

Clone Sequence Records

MIP19202.complete Sequence

391 bp assembled on 2010-03-23

GenBank Submission: BT122107.1

> MIP19202.complete
ATCGTAAATCACGAATGCAAGTTTGTGGCCAAAATGCGGAATAGCACTTT
GATTCTCATCGCCGTCGTTATGACTGTTTGCATTTTTGCGAATGTAACTG
GAGTAACTCGATGCAAGGGAAAGCCCAAGGATTCAAAGTGTGCCGGGAAT
CTCGATGGCGGTAACAATCGCAAAAGCAAATGCAAGAAATCGGCCAACAA
AAATATGTGGCACTACAATACACGGACAAAAAACTGCACACAATTCAACT
ACCTAGGATGTGGTGGCAATAATAATCGCTGGTGCACAAAAGCATTATGT
GAAGCCTGTCGACGACCAAGATAAAATATAATAGTTGAAATATATAAGTA
AATAAATAAATAGTTAGACAGAGAAAAAAAAAAAAAAAAAA

MIP19202.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
DMG4-MB6.chr3L.27.007.a 459 DMG4-MB6.chr3L.27.007.a 127..459 1..333 1665 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16022525..16022777 373..128 1080 96 Minus
chr3L 24539361 chr3L 16022834..16022960 127..1 635 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:21:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16032762..16033007 373..128 1230 100 Minus
3L 28110227 3L 16033064..16033190 127..1 635 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16025862..16026107 373..128 1230 100 Minus
3L 28103327 3L 16026164..16026290 127..1 635 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:21:58 has no hits.

MIP19202.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:22:51 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16022585..16022777 128..320 98 <- Minus
chr3L 16022834..16022960 1..127 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:56:58 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
CG42717-RA 1..291 34..324 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:18:34 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
CG42717-RA 1..291 34..324 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:03:49 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
CG42717-RA 1..291 34..324 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:56:58 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
CG42717-RA 1..324 10..333 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:18:34 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
CG42717-RA 1..373 1..373 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:03:49 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
CG42717-RA 1..373 1..373 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:51 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16032762..16033007 128..373 100 <- Minus
3L 16033064..16033190 1..127 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:51 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16032762..16033007 128..373 100 <- Minus
3L 16033064..16033190 1..127 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:51 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16032762..16033007 128..373 100 <- Minus
3L 16033064..16033190 1..127 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:18:34 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16025862..16026107 128..373 100 <- Minus
arm_3L 16026164..16026290 1..127 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:33:43 Download gff for MIP19202.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16025862..16026107 128..373 100 <- Minus
3L 16026164..16026290 1..127 100   Minus

MIP19202.hyp Sequence

Translation from 0 to 323

> MIP19202.hyp
IVNHECKFVAKMRNSTLILIAVVMTVCIFANVTGVTRCKGKPKDSKCAGN
LDGGNNRKSKCKKSANKNMWHYNTRTKNCTQFNYLGCGGNNNRWCTKALC
EACRRPR*

MIP19202.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG42717-PA 96 CG42717-PA 1..96 12..107 541 100 Plus
CG42538-PA 89 CG42538-PA 4..89 22..105 183 37.2 Plus
CG42713-PA 92 CG42713-PA 4..85 20..101 171 32.9 Plus
CG42713-PB 92 CG42713-PB 4..85 20..101 171 32.9 Plus
CG42537-PA 90 CG42537-PA 5..86 17..101 167 38.4 Plus

MIP19202.pep Sequence

Translation from 0 to 323

> MIP19202.pep
IVNHECKFVAKMRNSTLILIAVVMTVCIFANVTGVTRCKGKPKDSKCAGN
LDGGNNRKSKCKKSANKNMWHYNTRTKNCTQFNYLGCGGNNNRWCTKALC
EACRRPR*

MIP19202.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23759-PA 92 GF23759-PA 3..86 18..100 150 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25311-PA 92 GG25311-PA 3..90 19..105 140 31.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15461-PA 92 GH15461-PA 3..92 19..105 161 37.8 Plus
Dgri\GH15462-PA 141 GH15462-PA 3..82 19..96 155 38.8 Plus
Dgri\GH15463-PA 146 GH15463-PA 3..82 19..96 152 37.5 Plus
Dgri\GH15464-PA 114 GH15464-PA 1..82 17..96 150 39 Plus
Dgri\GH23271-PA 116 GH23271-PA 1..82 17..96 150 39 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42717-PA 96 CG42717-PA 1..96 12..107 541 100 Plus
CG42538-PA 89 CG42538-PA 4..89 22..105 183 37.2 Plus
CG42713-PA 92 CG42713-PA 4..85 20..101 171 32.9 Plus
CG42713-PB 92 CG42713-PB 4..85 20..101 171 32.9 Plus
CG42537-PA 90 CG42537-PA 5..86 17..101 167 38.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16654-PA 96 GI16654-PA 3..84 19..96 136 35.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20811-PA 90 GL20811-PA 3..86 17..101 175 40 Plus
Dper\GL22203-PA 92 GL22203-PA 3..86 17..101 170 38.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28299-PA 95 GA28299-PA 1..95 12..105 247 57.9 Plus
Dpse\GA28565-PA 90 GA28565-PA 3..86 17..101 177 40 Plus
Dpse\GA27412-PA 92 GA27412-PA 3..86 17..101 169 38.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25578-PA 89 GM25578-PA 3..89 17..105 167 39.3 Plus
Dsec\GM17228-PA 92 GM17228-PA 3..85 19..101 159 31.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14590-PA 89 GD14590-PA 3..89 17..105 169 39.3 Plus
Dsim\GD23572-PA 92 GD23572-PA 3..85 19..101 158 31.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13810-PA 91 GJ13810-PA 23..91 38..105 166 49.3 Plus
Dvir\GJ12489-PA 96 GJ12489-PA 3..89 17..101 165 36.4 Plus
Dvir\Kil-2-PA 111 GJ12491-PA 3..94 19..105 153 37 Plus
Dvir\GJ12906-PA 93 GJ12906-PA 3..86 17..100 149 32.1 Plus
Dvir\Kil-1-PA 113 GJ12487-PA 51..110 47..105 147 46.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23982-PA 91 GK23982-PA 3..91 18..105 155 37.1 Plus
Dwil\GK23993-PA 91 GK23993-PA 3..91 18..105 155 37.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23122-PA 119 GE23122-PA 1..58 12..69 269 91.4 Plus
Dyak\GE22885-PA 90 GE22885-PA 4..90 19..105 163 35.6 Plus
Dyak\GE19801-PA 90 GE19801-PA 4..90 19..105 163 35.6 Plus
Dyak\GE18803-PA 92 GE18803-PA 13..90 29..105 134 34.6 Plus