Clone MIP20204 Report

Search the DGRC for MIP20204

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:202
Well:4
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43063-RA
Protein status:MIP20204.pep: gold
Sequenced Size:504

Clone Sequence Records

MIP20204.complete Sequence

504 bp assembled on 2010-03-28

GenBank Submission: BT122144.1

> MIP20204.complete
ATGTTTTCACTTTGAATGGTTGTGCAATATGGAAATGCACTTCTCAGTAT
TTGTTGCGGTCACATTTCTTTTGCTGTCGGACATCACTCATCCGCTGGAG
ACCCTCGATGACTTTGAAGTCGCCGAGGAAATAACTACACCGCGCGAAAA
TGGGGATATTGTTGGTCCTCTTAATCCGAAACGCATCGAGGGACGAACTC
GACAAATGAGCGTACTATCTTTTGTGGGAAAAAACCGAACGGGCAAAATG
AATGAAAACTATTGCTGCTTCTGGATATATCAGGCCCATCCTCCCATTCC
TCACAGCTGGAAACATATGGCCGAGTATCCATTCGATTTTCAGTTCAACG
GAGAGTTTGTGCGGAACCAACGACACAATGAAGTTGAAGTGCCTGCAGTT
CAGGATGGCGACAGTGACAACTCAACAAGTGTAATTTGATATTAGACATT
GGCAAGATATATATTTTTCACTTAACAATCTAACACTTAAAAAAAAAAAA
AAAA

MIP20204.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:38:01 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8911524..8911959 53..488 2165 99.8 Plus
chr3R 27901430 chr3R 8911422..8911474 1..53 265 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:22:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13086326..13086763 53..490 2190 100 Plus
3R 32079331 3R 13086224..13086276 1..53 265 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12827157..12827594 53..490 2190 100 Plus
3R 31820162 3R 12827055..12827107 1..53 265 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:06:46 has no hits.

MIP20204.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:07:28 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8911422..8911474 1..53 100 -> Plus
chr3R 8911525..8911959 54..488 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:56:47 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
CG43063-RA 1..405 35..439 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:35:30 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
CG43063-RA 1..405 35..439 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:00:33 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
CG43063-RA 1..405 35..439 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:56:47 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
CG43063-RA 1..488 1..488 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:35:30 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
CG43063-RA 1..488 1..488 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:00:33 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
CG43063-RA 1..488 1..488 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:28 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13086224..13086276 1..53 100 -> Plus
3R 13086327..13086761 54..488 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:28 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13086224..13086276 1..53 100 -> Plus
3R 13086327..13086761 54..488 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:28 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13086224..13086276 1..53 100 -> Plus
3R 13086327..13086761 54..488 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:35:30 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8911946..8911998 1..53 100 -> Plus
arm_3R 8912049..8912483 54..488 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:33:31 Download gff for MIP20204.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12827158..12827592 54..488 100   Plus
3R 12827055..12827107 1..53 100 -> Plus

MIP20204.pep Sequence

Translation from 1 to 438

> MIP20204.pep
CFHFEWLCNMEMHFSVFVAVTFLLLSDITHPLETLDDFEVAEEITTPREN
GDIVGPLNPKRIEGRTRQMSVLSFVGKNRTGKMNENYCCFWIYQAHPPIP
HSWKHMAEYPFDFQFNGEFVRNQRHNEVEVPAVQDGDSDNSTSVI*

MIP20204.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19457-PA 236 GG19457-PA 127..234 31..138 455 75 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG43063-PA 134 CG43063-PA 1..134 12..145 727 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24393-PA 122 GL24393-PA 4..114 16..125 256 50.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26600-PA 122 GA26600-PA 1..114 12..125 247 47.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24086-PA 171 GM24086-PA 44..171 18..145 661 94.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18884-PA 171 GD18884-PA 44..171 18..145 652 92.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10365-PA 80 GJ10365-PA 7..75 64..130 187 47.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26248-PA 61 GE26248-PA 1..61 83..143 288 82 Plus

MIP20204.hyp Sequence

Translation from 1 to 438

> MIP20204.hyp
CFHFEWLCNMEMHFSVFVAVTFLLLSDITHPLETLDDFEVAEEITTPREN
GDIVGPLNPKRIEGRTRQMSVLSFVGKNRTGKMNENYCCFWIYQAHPPIP
HSWKHMAEYPFDFQFNGEFVRNQRHNEVEVPAVQDGDSDNSTSVI*

MIP20204.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG43063-PA 134 CG43063-PA 1..134 12..145 727 100 Plus