MIP20204.complete Sequence
504 bp assembled on 2010-03-28
GenBank Submission: BT122144.1
> MIP20204.complete
ATGTTTTCACTTTGAATGGTTGTGCAATATGGAAATGCACTTCTCAGTAT
TTGTTGCGGTCACATTTCTTTTGCTGTCGGACATCACTCATCCGCTGGAG
ACCCTCGATGACTTTGAAGTCGCCGAGGAAATAACTACACCGCGCGAAAA
TGGGGATATTGTTGGTCCTCTTAATCCGAAACGCATCGAGGGACGAACTC
GACAAATGAGCGTACTATCTTTTGTGGGAAAAAACCGAACGGGCAAAATG
AATGAAAACTATTGCTGCTTCTGGATATATCAGGCCCATCCTCCCATTCC
TCACAGCTGGAAACATATGGCCGAGTATCCATTCGATTTTCAGTTCAACG
GAGAGTTTGTGCGGAACCAACGACACAATGAAGTTGAAGTGCCTGCAGTT
CAGGATGGCGACAGTGACAACTCAACAAGTGTAATTTGATATTAGACATT
GGCAAGATATATATTTTTCACTTAACAATCTAACACTTAAAAAAAAAAAA
AAAA
MIP20204.complete Blast Records
Blast to MB8.fasta performed on 2010-07-15 21:38:01 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:06:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 8911524..8911959 | 53..488 | 2165 | 99.8 | Plus |
chr3R | 27901430 | chr3R | 8911422..8911474 | 1..53 | 265 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:22:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:06:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13086326..13086763 | 53..490 | 2190 | 100 | Plus |
3R | 32079331 | 3R | 13086224..13086276 | 1..53 | 265 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 12827157..12827594 | 53..490 | 2190 | 100 | Plus |
3R | 31820162 | 3R | 12827055..12827107 | 1..53 | 265 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 09:06:46 has no hits.
MIP20204.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:07:28 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 8911422..8911474 | 1..53 | 100 | -> | Plus |
chr3R | 8911525..8911959 | 54..488 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:56:47 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43063-RA | 1..405 | 35..439 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:35:30 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43063-RA | 1..405 | 35..439 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:00:33 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43063-RA | 1..405 | 35..439 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:56:47 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43063-RA | 1..488 | 1..488 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:35:30 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43063-RA | 1..488 | 1..488 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:00:33 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43063-RA | 1..488 | 1..488 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:28 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13086224..13086276 | 1..53 | 100 | -> | Plus |
3R | 13086327..13086761 | 54..488 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:28 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13086224..13086276 | 1..53 | 100 | -> | Plus |
3R | 13086327..13086761 | 54..488 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:07:28 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13086224..13086276 | 1..53 | 100 | -> | Plus |
3R | 13086327..13086761 | 54..488 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:35:30 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 8911946..8911998 | 1..53 | 100 | -> | Plus |
arm_3R | 8912049..8912483 | 54..488 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:33:31 Download gff for
MIP20204.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12827158..12827592 | 54..488 | 100 | | Plus |
3R | 12827055..12827107 | 1..53 | 100 | -> | Plus |
MIP20204.pep Sequence
Translation from 1 to 438
> MIP20204.pep
CFHFEWLCNMEMHFSVFVAVTFLLLSDITHPLETLDDFEVAEEITTPREN
GDIVGPLNPKRIEGRTRQMSVLSFVGKNRTGKMNENYCCFWIYQAHPPIP
HSWKHMAEYPFDFQFNGEFVRNQRHNEVEVPAVQDGDSDNSTSVI*
MIP20204.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:36:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG19457-PA | 236 | GG19457-PA | 127..234 | 31..138 | 455 | 75 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43063-PA | 134 | CG43063-PA | 1..134 | 12..145 | 727 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:36:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL24393-PA | 122 | GL24393-PA | 4..114 | 16..125 | 256 | 50.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:36:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA26600-PA | 122 | GA26600-PA | 1..114 | 12..125 | 247 | 47.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:36:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24086-PA | 171 | GM24086-PA | 44..171 | 18..145 | 661 | 94.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:36:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18884-PA | 171 | GD18884-PA | 44..171 | 18..145 | 652 | 92.2 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:36:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ10365-PA | 80 | GJ10365-PA | 7..75 | 64..130 | 187 | 47.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:36:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE26248-PA | 61 | GE26248-PA | 1..61 | 83..143 | 288 | 82 | Plus |
MIP20204.hyp Sequence
Translation from 1 to 438
> MIP20204.hyp
CFHFEWLCNMEMHFSVFVAVTFLLLSDITHPLETLDDFEVAEEITTPREN
GDIVGPLNPKRIEGRTRQMSVLSFVGKNRTGKMNENYCCFWIYQAHPPIP
HSWKHMAEYPFDFQFNGEFVRNQRHNEVEVPAVQDGDSDNSTSVI*
MIP20204.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:39:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43063-PA | 134 | CG43063-PA | 1..134 | 12..145 | 727 | 100 | Plus |