Clone MIP21415 Report

Search the DGRC for MIP21415

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:214
Well:15
Vector:pOT2
Associated Gene/TranscriptCG7582-RB
Protein status:MIP21415.pep: gold
Sequenced Size:996

Clone Sequence Records

MIP21415.complete Sequence

996 bp assembled on 2010-04-13

GenBank Submission: BT124761.1

> MIP21415.complete
GCAGCGCTCTCCGAGTTTCCCGCTCTCCACCAAACGGCAAAGGCTAAGTC
GCAAGGCCCAAAGTTGGTGCCATTCCTGGTTACTATTGTCCTATACTTCT
CGCTGGTGAGGAAGGATCCTCAAGGAGAGCTATGGACCACCGTGCTCAAA
TGCCTGCCCATTTTCGCGCTTGTATTCTATGTGGTGGCCAAGGGAATCTC
GCTCAAGAAGGAATACCGTCGCTCACTTTGGATTCTATTGGGTCTGGTTT
TCTCGAGTGGTGGTGATGCTCTGCTCAACATAAATCTCTTTCCCTTCGGA
ATGATCTCCTTTGGAGTGGCGCACGTGTTTTATATCAGCGCCTTTGGCTG
GAAGCCCATAAAGTGGTTCATTGGACTGCTCTTGTACGTGGCCGTATCGC
TTTTTGTTTACTTCGTGCACACGAAACTGGACGAGATTCTCATCATCGGA
GTGCCCATCTACTGTTTCCTGATCACCACAATGCTGTGGAGATCGCTGGC
CCGCGCCGTGGACTCCAGGAACTTCCTCGCCGTGTTCTGTGCCATCGGAG
CCATTCTGTTTGTGATCTCCGACGCCCTGATCGCGGTCACCATGTTCGTG
GGCGTGCCCCTGCCCTGCGCCCGCCTCCAGATCATGATCACCTACTACGC
CGCCCAGTTTGCCATTGCGCTGAGCACCGCGGACGACGGTCCTGCCCTCC
AGCGCTCCCTTCGCAAGAAAATTAAGTGAAGCCAGTGCCCAGTGCTCATC
TGTCGGAGGCCCAGAGACAACATGAACGCAACCACCAAACTTAGTACTTC
CAAAGCGTCTAGAGTATTGCCATTTACGTGTGTTGGTTTCCCCATCCCAG
TAGCTTAGTGCAACCAAATATTTGTTCCCTTTCTGATGGATGTGGAAACG
GATCTTAGTAGTTTACTAGATGTTTGTTGACTTCAAAGTAATAAATATAT
CAATAATAGGTTCTATTAACTATTTTATTAAAAAAAAAAAAAAAAA

MIP21415.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG7582-RA 1170 CG7582-RA 615..1170 404..959 2780 100 Plus
CG7582-RA 1170 CG7582-RA 197..557 43..403 1805 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25502859..25503434 979..404 2790 99 Minus
chr3R 27901430 chr3R 25503492..25503682 403..213 955 100 Minus
chr3R 27901430 chr3R 25503745..25503916 212..41 860 100 Minus
chr3R 27901430 chr3R 25504855..25504897 43..1 200 97.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:23:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29680236..29680816 984..404 2905 100 Minus
3R 32079331 3R 29680874..29681064 403..213 955 100 Minus
3R 32079331 3R 29681127..29681298 212..41 860 100 Minus
3R 32079331 3R 29682236..29682278 43..1 215 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29421067..29421647 984..404 2905 100 Minus
3R 31820162 3R 29421705..29421895 403..213 955 100 Minus
3R 31820162 3R 29421958..29422129 212..41 860 100 Minus
3R 31820162 3R 29423067..29423109 43..1 215 100 Minus
Blast to na_te.dros performed 2019-03-16 07:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsil\Loa 7779 Dsil\Loa DSV28T24 7779bp AKA(S39346) Derived from X60177 (Rel. 37, Last updated, Version 8). 192..261 975..904 120 66.7 Minus

MIP21415.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:07:26 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25502859..25503434 404..979 98 <- Minus
chr3R 25503492..25503682 213..403 100 <- Minus
chr3R 25503745..25503914 43..212 100 <- Minus
chr3R 25504856..25504897 1..42 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-19 15:45:52 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
CG7582-RA 14..382 36..403 98 -> Plus
CG7582-RA 440..765 404..729 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:55:38 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
CG7582-RA 440..765 404..729 100   Plus
CG7582-RA 14..382 36..403 98 -> Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:39:39 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
CG7582-RB 1..429 301..729 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:28:08 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
CG7582-RB 1..429 301..729 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 15:45:52 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
CG7582-RA 189..557 36..403 98 -> Plus
CG7582-RA 615..1170 404..959 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:55:38 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
CG7582-RA 189..557 36..403 98 -> Plus
CG7582-RA 615..1170 404..959 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:39:39 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
CG7582-RB 1..979 1..979 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:28:08 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
CG7582-RB 1..979 1..979 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:07:26 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29682237..29682278 1..42 100   Minus
3R 29680241..29680816 404..979 100 <- Minus
3R 29680874..29681064 213..403 100 <- Minus
3R 29681127..29681296 43..212 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:07:26 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29682237..29682278 1..42 100   Minus
3R 29680241..29680816 404..979 100 <- Minus
3R 29680874..29681064 213..403 100 <- Minus
3R 29681127..29681296 43..212 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:07:26 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29682237..29682278 1..42 100   Minus
3R 29680241..29680816 404..979 100 <- Minus
3R 29680874..29681064 213..403 100 <- Minus
3R 29681127..29681296 43..212 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:39:39 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25505963..25506538 404..979 100 <- Minus
arm_3R 25506596..25506786 213..403 100 <- Minus
arm_3R 25506849..25507018 43..212 100 <- Minus
arm_3R 25507959..25508000 1..42 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:47:05 Download gff for MIP21415.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29421072..29421647 404..979 100 <- Minus
3R 29421705..29421895 213..403 100 <- Minus
3R 29421958..29422127 43..212 100 <- Minus
3R 29423068..29423109 1..42 100   Minus

MIP21415.pep Sequence

Translation from 0 to 728

> MIP21415.pep
AALSEFPALHQTAKAKSQGPKLVPFLVTIVLYFSLVRKDPQGELWTTVLK
CLPIFALVFYVVAKGISLKKEYRRSLWILLGLVFSSGGDALLNINLFPFG
MISFGVAHVFYISAFGWKPIKWFIGLLLYVAVSLFVYFVHTKLDEILIIG
VPIYCFLITTMLWRSLARAVDSRNFLAVFCAIGAILFVISDALIAVTMFV
GVPLPCARLQIMITYYAAQFAIALSTADDGPALQRSLRKKIK*

MIP21415.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22875-PA 237 GF22875-PA 8..237 15..242 1048 87.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12009-PA 317 GG12009-PA 8..65 15..72 291 94.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18684-PA 229 GH18684-PA 4..229 15..242 839 72.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG7582-PA 254 CG7582-PA 8..254 15..242 1124 91.9 Plus
CG7582-PB 142 CG7582-PB 1..142 101..242 721 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24195-PA 233 GI24195-PA 3..224 10..231 856 73.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13582-PA 235 GL13582-PA 9..235 16..242 1024 84.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20455-PA 235 GA20455-PA 9..235 16..242 1024 84.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12231-PA 235 GM12231-PA 8..235 15..242 1145 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17691-PA 45 GD17691-PA 1..45 198..242 229 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11568-PA 186 GJ11568-PA 2..176 56..230 476 56.6 Plus
Dvir\GJ10541-PA 84 GJ10541-PA 1..77 58..134 302 72.7 Plus
Dvir\GJ10543-PA 80 GJ10543-PA 1..71 161..231 299 83.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11173-PA 240 GK11173-PA 7..240 13..240 958 76.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10440-PA 235 GE10440-PA 8..235 15..242 1134 96.1 Plus

MIP21415.hyp Sequence

Translation from 0 to 728

> MIP21415.hyp
AALSEFPALHQTAKAKSQGPKLVPFLVTIVLYFSLVRKDPQGELWTTVLK
CLPIFALVFYVVAKGISLKKEYRRSLWILLGLVFSSGGDALLNINLFPFG
MISFGVAHVFYISAFGWKPIKWFIGLLLYVAVSLFVYFVHTKLDEILIIG
VPIYCFLITTMLWRSLARAVDSRNFLAVFCAIGAILFVISDALIAVTMFV
GVPLPCARLQIMITYYAAQFAIALSTADDGPALQRSLRKKIK*

MIP21415.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG7582-PA 254 CG7582-PA 8..254 15..242 1124 91.9 Plus
CG7582-PB 142 CG7582-PB 1..142 101..242 721 100 Plus