Clone MIP21801 Report

Search the DGRC for MIP21801

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:218
Well:1
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcriptpes-RE
Protein status:MIP21801.pep: gold
Sequenced Size:554

Clone Sequence Records

MIP21801.complete Sequence

554 bp assembled on 2010-04-20

GenBank Submission: BT124777.1

> MIP21801.complete
GAAGACGCCCTGCAAACAAAGAACATCAATTTACAGCACCGCCACCAAGA
CTCAGGCGCAGCTCCACCAAGATGACATCACGGACGCGCCACTGTGCCCG
ACTGGGGATCGTTCTCCTTGGGATCTGTTGCATCGCCAGCGGAATTTACC
TCTTCCGCAACTGGATCGATATGTTTACACGCATGCGCGGCCAGACCTTT
GGGTTAAGTTTCGCAAGCCGGCAAATTGGCAATGTGTGCAGAGGTCAACT
GGGAGACTCATTTGCATACCACTTGGATTGGGAGGCAACAATTTTTTCCA
TTGATTTAAAGCAAAGACGAACGCAAAGACACTGAAAATTGACTGTGTGC
AGGTGTTCGAGTAATTCCAAATCACCCCAAGCCAATAGATAAGATAAGGA
CTAACAACAGGCGAAATAATACCTTATAGAGAACATTTTGTAACGTTATT
GTTTGGGGGTGGTAAAAATATAAAAATCTTATAAGATCCTAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

MIP21801.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
pes.e 2593 pes.e 91..284 1..194 970 100 Plus
pes.c 2608 pes.c 106..299 1..194 970 100 Plus
pes.a 2619 pes.a 117..310 1..194 970 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7990018..7990317 490..192 1420 99 Minus
chr2L 23010047 chr2L 7990413..7990606 194..1 970 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:23:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7990961..7991262 493..192 1510 100 Minus
2L 23513712 2L 7991358..7991551 194..1 970 100 Minus
2R 25286936 2R 5908670..5908736 530..464 185 85.1 Minus
3L 28110227 3L 1507038..1507103 464..529 180 84.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7990961..7991262 493..192 1510 100 Minus
2L 23513712 2L 7991358..7991551 194..1 970 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:48:06 has no hits.

MIP21801.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:48:53 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7990018..7990314 195..490 98 <- Minus
chr2L 7990413..7990606 1..194 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-20 10:34:22 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RD 1..123 72..194 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:56:21 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RD 1..123 72..194 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:29:43 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RE 1..264 72..335 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:35:41 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RE 1..264 72..335 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-20 10:34:21 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RC 411..604 1..194 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:56:21 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RC 411..604 1..194 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:29:43 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RE 30..519 1..490 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:41 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RE 30..519 1..490 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:48:53 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7990964..7991259 195..490 100 <- Minus
2L 7991358..7991551 1..194 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:48:53 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7990964..7991259 195..490 100 <- Minus
2L 7991358..7991551 1..194 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:48:53 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7990964..7991259 195..490 100 <- Minus
2L 7991358..7991551 1..194 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:29:43 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7990964..7991259 195..490 100 <- Minus
arm_2L 7991358..7991551 1..194 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:47:52 Download gff for MIP21801.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7990964..7991259 195..490 100 <- Minus
2L 7991358..7991551 1..194 100   Minus

MIP21801.pep Sequence

Translation from 2 to 334

> MIP21801.pep
RRPANKEHQFTAPPPRLRRSSTKMTSRTRHCARLGIVLLGICCIASGIYL
FRNWIDMFTRMRGQTFGLSFASRQIGNVCRGQLGDSFAYHLDWEATIFSI
DLKQRRTQRH*

MIP21801.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23406-PA 557 GF23406-PA 1..50 24..73 222 78 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23490-PA 555 GG23490-PA 1..50 24..73 210 76 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13076-PA 559 GH13076-PA 1..51 24..73 182 68.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
pes-PE 87 CG7228-PE 1..87 24..110 467 100 Plus
pes-PF 555 CG7228-PF 1..50 24..73 232 90 Plus
pes-PH 555 CG7228-PH 1..50 24..73 232 90 Plus
pes-PG 555 CG7228-PG 1..50 24..73 232 90 Plus
pes-PD 555 CG7228-PD 1..50 24..73 232 90 Plus
pes-PC 555 CG7228-PC 1..50 24..73 232 90 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17695-PA 559 GI17695-PA 1..50 24..72 189 68 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18893-PA 558 GL18893-PA 1..50 24..73 193 68 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20196-PA 558 GA20196-PA 1..50 24..73 193 68 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13246-PA 555 GM13246-PA 1..50 24..73 242 86 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22453-PA 94 GD22453-PA 1..51 24..74 230 86.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17482-PA 559 GJ17482-PA 1..50 24..72 198 72 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14976-PA 566 GK14976-PA 1..50 24..73 227 80 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11255-PA 555 GE11255-PA 1..50 24..73 230 84 Plus

MIP21801.hyp Sequence

Translation from 2 to 334

> MIP21801.hyp
RRPANKEHQFTAPPPRLRRSSTKMTSRTRHCARLGIVLLGICCIASGIYL
FRNWIDMFTRMRGQTFGLSFASRQIGNVCRGQLGDSFAYHLDWEATIFSI
DLKQRRTQRH*

MIP21801.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
pes-PE 87 CG7228-PE 1..87 24..110 467 100 Plus
pes-PF 555 CG7228-PF 1..50 24..73 232 90 Plus
pes-PH 555 CG7228-PH 1..50 24..73 232 90 Plus
pes-PG 555 CG7228-PG 1..50 24..73 232 90 Plus
pes-PD 555 CG7228-PD 1..50 24..73 232 90 Plus