Clone MIP22444 Report

Search the DGRC for MIP22444

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:224
Well:44
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43449-RA
Protein status:MIP22444.pep: gold
Sequenced Size:530

Clone Sequence Records

MIP22444.complete Sequence

530 bp assembled on 2010-06-01

GenBank Submission: BT124928.1

> MIP22444.complete
TTTTAAGCCTATTAAGCAATGAACAATCTGTGGCGCGAAATCGGCTTTAT
TACCAAGCGAAGGCCGAAGAAACATGTGAAAATCATTCGGATCAAGAAAC
GCGTTGCCAAATCGAAGAAAGTCTTCAAGCGAAGGCAATATGAACTGATA
CAACTTCATTTGAGAAATCGTATAAAGTATTTAATTATCGAAAATCTGGA
GCAAGCCTTGGCAAAAATCCAAACTAAGAAAGGGATTCAGAAGAGCTTAA
AGTAACATAAACCTAAGTTATGAAAATTAAAATTATTATTATTGAGAAAT
TACCAGTATTGCTAGATAGATAATCTTAAAATTACTGCCCATTTGATTTC
CCAAACTGTTTCACAGTAAATTAGACCATTTTCAAAGAAAAAGCGAACAT
AAACAATAGACGGAAGTGAAATCAATTTCAATTGTTTGCTACCCCATTGA
GATGATTAAAATTTGAAATAAAATCTCGTTGGTCGGCTACCACACACACA
ATCATTTTCAAACTAAAAAAAAAAAAAAAA

MIP22444.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:38:44 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6913954..6914467 1..514 2540 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11088420..11088933 1..514 2570 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10829251..10829764 1..514 2570 100 Plus
Blast to na_te.dros performed 2019-03-16 17:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 1338..1411 361..287 110 65.8 Minus

MIP22444.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:46:23 Download gff for MIP22444.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6913954..6914467 1..514 95   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:37 Download gff for MIP22444.complete
Subject Subject Range Query Range Percent Splice Strand
CG43449-RA 1..237 19..255 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:17:22 Download gff for MIP22444.complete
Subject Subject Range Query Range Percent Splice Strand
CG43449-RA 1..237 19..255 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:37 Download gff for MIP22444.complete
Subject Subject Range Query Range Percent Splice Strand
CG43449-RA 1..514 1..514 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:17:22 Download gff for MIP22444.complete
Subject Subject Range Query Range Percent Splice Strand
CG43449-RA 1..514 1..514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:46:23 Download gff for MIP22444.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11088420..11088933 1..514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:46:23 Download gff for MIP22444.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11088420..11088933 1..514 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:46:23 Download gff for MIP22444.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11088420..11088933 1..514 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:37 Download gff for MIP22444.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6914142..6914655 1..514 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:36:19 Download gff for MIP22444.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10829251..10829764 1..514 100   Plus

MIP22444.pep Sequence

Translation from 18 to 254

> MIP22444.pep
MNNLWREIGFITKRRPKKHVKIIRIKKRVAKSKKVFKRRQYELIQLHLRN
RIKYLIIENLEQALAKIQTKKGIQKSLK*

MIP22444.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG43449-PB 78 CG43449-PB 1..78 1..78 389 100 Plus
CG43449-PA 78 CG43449-PA 1..78 1..78 389 100 Plus

MIP22444.hyp Sequence

Translation from 18 to 254

> MIP22444.hyp
MNNLWREIGFITKRRPKKHVKIIRIKKRVAKSKKVFKRRQYELIQLHLRN
RIKYLIIENLEQALAKIQTKKGIQKSLK*

MIP22444.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG43449-PB 78 CG43449-PB 1..78 1..78 389 100 Plus
CG43449-PA 78 CG43449-PA 1..78 1..78 389 100 Plus