Clone MIP22488 Report

Search the DGRC for MIP22488

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:224
Well:88
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43167-RA
Protein status:MIP22488.pep: gold
Sequenced Size:557

Clone Sequence Records

MIP22488.complete Sequence

557 bp assembled on 2010-06-01

GenBank Submission: BT124937.1

> MIP22488.complete
ATTTCAAAAATGGATTCGATTATTGAAAAGCTCAAGCGCTTTATTTCCGT
GGCGTTTCTGTTTAATAAGCTGTTATTTTACGTATTCATTTCTGGTCTGT
TTATCTTAATTTTTATTCGACTTTTCATGATGGAGCGCCTTCAACGATTG
AAGGCAATAATCTGGAGAAGCTTTTCCGAATATGACCACGAATCTGAGCC
AGAAGATGAAGGATACATAGATGATGAGTTTCTATTCAGGGACCTCAATC
CGGAGCAGAGTGTCGAGTTGCATCGCCGGCAGCGATTGGAGGCGGCAGCT
AAAGTATTGCGAAATGTGGCGGACAAGGAGGGATCTCACAAGTGCCCCGA
ACCGAGACGAAAGAAAACTGAACCAACAAAATCAAGATAAATTATGGATG
GTTCCAGAAATATGCCAAATACCTAAGATAATTTCTATTCATCGGGAATT
GTTAAAAATAACACATTTGACGTTACTGACCATAACCGAATATCCAAACG
AAATGAACTAAATACAATTCCATGCCCAGTCGTAAAAAAAAAAAAAAAAA
AAAAAAA

MIP22488.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:38:51 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11656185..11656721 1..533 2515 98.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11657460..11657994 1..535 2675 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11657460..11657994 1..535 2675 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:09:48 has no hits.

MIP22488.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:10:29 Download gff for MIP22488.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11656185..11656721 1..533 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:05:32 Download gff for MIP22488.complete
Subject Subject Range Query Range Percent Splice Strand
CG43167-RA 1..381 10..390 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:29:43 Download gff for MIP22488.complete
Subject Subject Range Query Range Percent Splice Strand
CG43167-RA 1..381 10..390 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:05:32 Download gff for MIP22488.complete
Subject Subject Range Query Range Percent Splice Strand
CG43167-RA 51..583 1..533 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:29:43 Download gff for MIP22488.complete
Subject Subject Range Query Range Percent Splice Strand
CG43167-RA 51..583 1..533 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:10:29 Download gff for MIP22488.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11657460..11657992 1..533 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:10:29 Download gff for MIP22488.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11657460..11657992 1..533 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:10:29 Download gff for MIP22488.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11657460..11657992 1..533 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:05:32 Download gff for MIP22488.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11657460..11657992 1..533 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:36:33 Download gff for MIP22488.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11657460..11657992 1..533 100   Plus

MIP22488.pep Sequence

Translation from 0 to 389

> MIP22488.pep
ISKMDSIIEKLKRFISVAFLFNKLLFYVFISGLFILIFIRLFMMERLQRL
KAIIWRSFSEYDHESEPEDEGYIDDEFLFRDLNPEQSVELHRRQRLEAAA
KVLRNVADKEGSHKCPEPRRKKTEPTKSR*

MIP22488.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23730-PA 128 GG23730-PA 1..128 4..129 475 74.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG43167-PA 126 CG43167-PA 1..126 4..129 645 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18534-PA 86 GE18534-PA 1..86 44..129 407 89.5 Plus

MIP22488.hyp Sequence

Translation from 0 to 389

> MIP22488.hyp
ISKMDSIIEKLKRFISVAFLFNKLLFYVFISGLFILIFIRLFMMERLQRL
KAIIWRSFSEYDHESEPEDEGYIDDEFLFRDLNPEQSVELHRRQRLEAAA
KVLRNVADKEGSHKCPEPRRKKTEPTKSR*

MIP22488.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG43167-PA 126 CG43167-PA 1..126 4..129 645 100 Plus