Clone MIP22490 Report

Search the DGRC for MIP22490

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:224
Well:90
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43401-RA
Protein status:MIP22490.pep: gold
Sequenced Size:491

Clone Sequence Records

MIP22490.complete Sequence

491 bp assembled on 2010-06-01

GenBank Submission: BT124949.1

> MIP22490.complete
ATCAAATAAAATTAGAAACGCACAATAGTTCTTAAATCCGTATCACAAGA
TAATATCTTGAATATACAAATATTTCTTGTAGTGATATCCCCTGTGGGGC
GTGCCCATCGACATCGATTTGGACTGTTTCGTGCGCTGGGGAAAATGTTT
CAAAATTGATGTTCACCTTCTGCCATGTTTGCCAACCCTCCTTGGAAGTC
GGGGGACTCCTCCTAATGACTCGGAATATGTTTTGCCGTATTCGTAGCAT
TAACATTCCTTCGCAGCCGAAAATGTCTTCAGAACATATAGTGGATGTTG
CGCAAACAGGCTTAAGTAGAACTCATCCGAGTAAGTAGCTCATGGATGTC
ACTGGAAACTGTTGTGCTGATGGCTTTCTGGGATTGGCATGGCTTCGAGT
GCATCGGCGGTTAATTATACTTACAAAGATTTTGTGTGGCATATTCGGAA
TTAAAATTAATGATCTCCGATGAAAAAAAAAAAAAAAAAAA

MIP22490.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:38:59 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1428413..1428884 1..472 2360 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1428510..1428985 1..476 2380 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1428510..1428985 1..476 2380 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:10:35 has no hits.

MIP22490.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:11:12 Download gff for MIP22490.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1428413..1428884 1..472 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:35:45 Download gff for MIP22490.complete
Subject Subject Range Query Range Percent Splice Strand
CG43401-RB 1..180 159..338 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:02:32 Download gff for MIP22490.complete
Subject Subject Range Query Range Percent Splice Strand
CG43401-RB 1..180 159..338 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:35:45 Download gff for MIP22490.complete
Subject Subject Range Query Range Percent Splice Strand
CG43401-RB 37..508 1..472 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:02:32 Download gff for MIP22490.complete
Subject Subject Range Query Range Percent Splice Strand
CG43401-RB 37..508 1..472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:11:12 Download gff for MIP22490.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1428510..1428981 1..472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:11:12 Download gff for MIP22490.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1428510..1428981 1..472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:11:12 Download gff for MIP22490.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1428510..1428981 1..472 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:35:45 Download gff for MIP22490.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1428510..1428981 1..472 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:36:50 Download gff for MIP22490.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1428510..1428981 1..472 100   Plus

MIP22490.pep Sequence

Translation from 158 to 337

> MIP22490.pep
MFTFCHVCQPSLEVGGLLLMTRNMFCRIRSINIPSQPKMSSEHIVDVAQT
GLSRTHPSK*

MIP22490.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG43401-PA 59 CG43401-PA 1..59 1..59 312 100 Plus
CG43401-PB 59 CG43401-PB 1..59 1..59 312 100 Plus

MIP22490.hyp Sequence

Translation from 158 to 337

> MIP22490.hyp
MFTFCHVCQPSLEVGGLLLMTRNMFCRIRSINIPSQPKMSSEHIVDVAQT
GLSRTHPSK*

MIP22490.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG43401-PA 59 CG43401-PA 1..59 1..59 312 100 Plus
CG43401-PB 59 CG43401-PB 1..59 1..59 312 100 Plus