Clone MIP22495 Report

Search the DGRC for MIP22495

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:224
Well:95
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42781-RA
Protein status:MIP22495.pep: gold
Sequenced Size:311

Clone Sequence Records

MIP22495.complete Sequence

311 bp assembled on 2010-06-03

GenBank Submission: BT124981.1

> MIP22495.complete
ATTGGTTCAAGTTTTAGTTGACTTCGAGATCTCAAAAAATCCACCAGCCA
TGTCCCCTGGCCACTTAATCCTGCTGCAGTTCAGCATGCACTGTTTCAAG
ATCATTTTCATCTATTGCATCTGTGTTAATGTCCTGGAGCATCTTGTTCA
AAGCGTCCAGGAACACTGAACGGGATAATGCTGGGGGCCAGAATACGGAA
TCAATAAAAAACGGCATCTATTTCAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

MIP22495.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:33:11 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7274664..7274887 224..1 1120 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7382729..7382956 228..1 1140 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7390827..7391054 228..1 1140 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:32:06 has no hits.

MIP22495.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:33:11 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7274664..7274887 1..224 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:49:43 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 1..120 50..169 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:20:51 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 1..120 50..169 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:41:45 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 1..120 50..169 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:49:43 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 1..120 50..169 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:51 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 1..224 1..224 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:41:45 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
CG42781-RA 35..258 1..224 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:11 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
X 7382733..7382956 1..224 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:11 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
X 7382733..7382956 1..224 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:11 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
X 7382733..7382956 1..224 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:51 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7276766..7276989 1..224 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:25:30 Download gff for MIP22495.complete
Subject Subject Range Query Range Percent Splice Strand
X 7390831..7391054 1..224 100   Minus

MIP22495.hyp Sequence

Translation from 0 to 168

> MIP22495.hyp
LVQVLVDFEISKNPPAMSPGHLILLQFSMHCFKIIFIYCICVNVLEHLVQ
SVQEH*

MIP22495.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG42781-PA 39 CG42781-PA 1..39 17..55 211 100 Plus

MIP22495.pep Sequence

Translation from 49 to 168

> MIP22495.pep
MSPGHLILLQFSMHCFKIIFIYCICVNVLEHLVQSVQEH*

MIP22495.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42781-PA 39 CG42781-PA 1..39 1..39 211 100 Plus