MIP22495.complete Sequence
311 bp assembled on 2010-06-03
GenBank Submission: BT124981.1
> MIP22495.complete
ATTGGTTCAAGTTTTAGTTGACTTCGAGATCTCAAAAAATCCACCAGCCA
TGTCCCCTGGCCACTTAATCCTGCTGCAGTTCAGCATGCACTGTTTCAAG
ATCATTTTCATCTATTGCATCTGTGTTAATGTCCTGGAGCATCTTGTTCA
AAGCGTCCAGGAACACTGAACGGGATAATGCTGGGGGCCAGAATACGGAA
TCAATAAAAAACGGCATCTATTTCAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA
MIP22495.complete Blast Records
Blast to MB8.fasta performed on 2010-07-15 21:33:11 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:32:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 7274664..7274887 | 224..1 | 1120 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:32:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7382729..7382956 | 228..1 | 1140 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 7390827..7391054 | 228..1 | 1140 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 18:32:06 has no hits.
MIP22495.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:33:11 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 7274664..7274887 | 1..224 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:49:43 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 1..120 | 50..169 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:20:51 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 1..120 | 50..169 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:41:45 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 1..120 | 50..169 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:49:43 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 1..120 | 50..169 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:51 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 1..224 | 1..224 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:41:45 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42781-RA | 35..258 | 1..224 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:11 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7382733..7382956 | 1..224 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:11 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7382733..7382956 | 1..224 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:11 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7382733..7382956 | 1..224 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:51 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7276766..7276989 | 1..224 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:25:30 Download gff for
MIP22495.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7390831..7391054 | 1..224 | 100 | | Minus |
MIP22495.hyp Sequence
Translation from 0 to 168
> MIP22495.hyp
LVQVLVDFEISKNPPAMSPGHLILLQFSMHCFKIIFIYCICVNVLEHLVQ
SVQEH*
MIP22495.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:38:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42781-PA | 39 | CG42781-PA | 1..39 | 17..55 | 211 | 100 | Plus |
MIP22495.pep Sequence
Translation from 49 to 168
> MIP22495.pep
MSPGHLILLQFSMHCFKIIFIYCICVNVLEHLVQSVQEH*
MIP22495.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42781-PA | 39 | CG42781-PA | 1..39 | 1..39 | 211 | 100 | Plus |