Clone MIP22670 Report

Search the DGRC for MIP22670

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:226
Well:70
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43407-RA
Protein status:MIP22670.pep: gold
Sequenced Size:396

Clone Sequence Records

MIP22670.complete Sequence

396 bp assembled on 2010-06-01

GenBank Submission: BT124946.1

> MIP22670.complete
TTTTTTCGCACGGGTGGCTTTCGACGTGGCTGAACTGTCCAGAGAGATCC
GACTCTCGGCTGAGATTGCGGTGCAACTTCAAAGGAAGTGTGATGGGCGA
ATGTGTGAGGTGGCCGCCTGCGGACCGGGCTGAAATGAACATGCACACAT
GCTGGCGAAGGGGCGGAGAAAATTTCAGAGGAGGGGGAGTGCCCAGAGCA
GGAGGATCGGGTCTGTCCAGCTAATCAAGCATCAACTTCATCATCATCAA
CGCGGATGCACCGTGAACAGTTACTCATATAGGAAATGCATGGGTAATCG
GAGGAAAATGAGCGGCGTGGCTTTGATGAGTTGCAGATAAATATAGTTTC
ACAGTTATTATGAGGATGAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP22670.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:38:57 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19042569..19042936 368..1 1825 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19053022..19053389 368..1 1840 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19046122..19046489 368..1 1840 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:23:42 has no hits.

MIP22670.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:24:34 Download gff for MIP22670.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19042569..19042936 1..368 99   Minus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:34:33 Download gff for MIP22670.complete
Subject Subject Range Query Range Percent Splice Strand
CG43407-RB 1..132 93..224 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:06 Download gff for MIP22670.complete
Subject Subject Range Query Range Percent Splice Strand
CG43407-RB 1..132 93..224 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:34:33 Download gff for MIP22670.complete
Subject Subject Range Query Range Percent Splice Strand
CG43407-RB 1..368 1..368 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:06 Download gff for MIP22670.complete
Subject Subject Range Query Range Percent Splice Strand
CG43407-RB 1..368 1..368 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:24:34 Download gff for MIP22670.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19053022..19053389 1..368 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:24:34 Download gff for MIP22670.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19053022..19053389 1..368 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:24:34 Download gff for MIP22670.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19053022..19053389 1..368 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:34:33 Download gff for MIP22670.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19046122..19046489 1..368 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:36:46 Download gff for MIP22670.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19046122..19046489 1..368 100   Minus

MIP22670.pep Sequence

Translation from 2 to 223

> MIP22670.pep
FSHGWLSTWLNCPERSDSRLRLRCNFKGSVMGECVRWPPADRAEMNMHTC
WRRGGENFRGGGVPRAGGSGLSS*

MIP22670.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG43407-PA 43 CG43407-PA 1..43 31..73 248 100 Plus
CG43407-PB 43 CG43407-PB 1..43 31..73 248 100 Plus

MIP22670.hyp Sequence

Translation from 2 to 223

> MIP22670.hyp
FSHGWLSTWLNCPERSDSRLRLRCNFKGSVMGECVRWPPADRAEMNMHTC
WRRGGENFRGGGVPRAGGSGLSS*

MIP22670.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG43407-PA 43 CG43407-PA 1..43 31..73 248 100 Plus
CG43407-PB 43 CG43407-PB 1..43 31..73 248 100 Plus