Clone MIP22685 Report

Search the DGRC for MIP22685

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:226
Well:85
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43447-RA
Protein status:MIP22685.pep: gold
Sequenced Size:563

Clone Sequence Records

MIP22685.complete Sequence

563 bp assembled on 2010-06-01

GenBank Submission: BT124935.1

> MIP22685.complete
TTTTTTACGCAGCAAGCTGCTTGAATGATTGACAGCTGGACATTGTGGCT
GAGTGAATAACTCACAGGCCGACAGGCCGACTGGCCGCTTGATTTATGGG
GGCGTGCCCCGGACAGCCGTGCTTTGGCGCTCAATTAAAACGGAACCAAA
GTCAAAAGTCACCGAGCGATATGGGAAGCCCACGGAGTCCTAGTTCTAGC
TGCGATGGATTAACACATCTCCCGGGGCAACATCTCTCCCGGCGACAACC
CTCATGGCAAGGTCTTTTGCTCGAAGGCTGGCCTGTCATATAAATCAAGC
ATAATCAACGCGAAATGCGGCTTGACTCTCCATAGATGGACTCCGATGCG
AGATTCCCGGATAAGCTGCACTCGAAGAAAAAGGGGGTACGCTATCTATC
GATGGGAATATTGAAGGAACTCAGTATAGGTATATAGGTAACAATTTGAT
TATGACTAACTTATGGTCATAACTATCATCTGTTCATTTACTAAATAAAT
ATCAAGCTATTTATTATTGTTGAACTATGGCCACCAAAAAAAAAAAAAAA
AAAAAAAAAAAAA

MIP22685.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:38:49 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23263231..23263764 1..534 2655 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27440312..27440845 1..534 2670 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27181143..27181676 1..534 2670 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:40:04 has no hits.

MIP22685.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:40:50 Download gff for MIP22685.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23263231..23263764 1..535 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:09:16 Download gff for MIP22685.complete
Subject Subject Range Query Range Percent Splice Strand
CG43447-RA 1..198 96..293 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:50:49 Download gff for MIP22685.complete
Subject Subject Range Query Range Percent Splice Strand
CG43447-RA 1..198 96..293 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:09:16 Download gff for MIP22685.complete
Subject Subject Range Query Range Percent Splice Strand
CG43447-RA 1..534 1..534 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:50:49 Download gff for MIP22685.complete
Subject Subject Range Query Range Percent Splice Strand
CG43447-RA 1..534 1..534 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:40:50 Download gff for MIP22685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27440312..27440845 1..535 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:40:50 Download gff for MIP22685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27440312..27440845 1..535 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:40:50 Download gff for MIP22685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27440312..27440845 1..535 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:09:16 Download gff for MIP22685.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23266034..23266567 1..535 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:36:31 Download gff for MIP22685.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27181143..27181676 1..535 99   Plus

MIP22685.pep Sequence

Translation from 95 to 292

> MIP22685.pep
MGACPGQPCFGAQLKRNQSQKSPSDMGSPRSPSSSCDGLTHLPGQHLSRR
QPSWQGLLLEGWPVI*

MIP22685.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG43447-PA 65 CG43447-PA 1..65 1..65 362 100 Plus

MIP22685.hyp Sequence

Translation from 95 to 292

> MIP22685.hyp
MGACPGQPCFGAQLKRNQSQKSPSDMGSPRSPSSSCDGLTHLPGQHLSRR
QPSWQGLLLEGWPVI*

MIP22685.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG43447-PA 65 CG43447-PA 1..65 1..65 362 100 Plus