Clone MIP22882 Report

Search the DGRC for MIP22882

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:228
Well:82
Vector:pOT2
Associated Gene/TranscriptCG42792-RA
Protein status:MIP22882.pep: gold
Sequenced Size:417

Clone Sequence Records

MIP22882.complete Sequence

417 bp assembled on 2010-06-01

GenBank Submission: BT124958.1

> MIP22882.complete
CTAAAGATGTCTCCTAAGTTCGCACTTGCAGTTCTGCTCCTCAGCTGCGT
TCTCCTAGGACTGGCCAATGCCCAGTATAACAGGCGCTATCAGACTGGGC
CTAACCGACAAAAAATTGGGACTCGAATGAATGCGGACGGCCCTTTGCCG
CCAAATTTCCCCCCTCCGGCTGATAATGCTGGTGGCAGTGATGTCCCGGC
CAACGTGGATTGCATGCCCAATCTATTGGCTAGTAACACCCTTGATACCA
GGAAACCTAGGCCCAAGCATTAAAAACCCAAAAAGTTCAACTCCTAAACG
GACCCGAATATATAGTAAGCTGATGGAGTCCGCAGTAATTGATTTTAAAT
GAAAAATGGATTTTTTTTTTTAAATTAAAAAATGCATTTACTTTCGTAAA
AAAAAAAAAAAAAAAAA

MIP22882.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:39:06 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15863746..15864028 397..115 1415 100 Minus
chr2L 23010047 chr2L 15864094..15864207 114..1 555 99.1 Minus
chr2L 23010047 chr2L 15881855..15881968 114..1 465 93.9 Minus
chr2L 23010047 chr2L 15881652..15881763 273..162 455 93.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15864960..15865250 405..115 1440 99.7 Minus
2L 23513712 2L 15865316..15865429 114..1 570 100 Minus
2L 23513712 2L 15883066..15883179 114..1 465 93.9 Minus
2L 23513712 2L 15882863..15882974 273..162 455 93.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15864960..15865250 405..115 1440 99.6 Minus
2L 23513712 2L 15865316..15865429 114..1 570 100 Minus
2L 23513712 2L 15883066..15883179 114..1 465 93.8 Minus
2L 23513712 2L 15882863..15882974 273..162 455 93.7 Minus
2L 23513712 2L 15882971..15883000 144..115 150 100 Minus
Blast to na_te.dros performed 2019-03-15 18:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 6444..6521 379..307 107 65.4 Minus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 27..70 245..285 105 75 Plus
Dmau\mariner 1286 Dmau\mariner DMMAR 1286bp Derived from M14653 (Rel. 63, Last updated, Version 2). 638..661 349..372 102 91.7 Plus

MIP22882.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:56:22 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15863785..15864028 115..358 100 <- Minus
chr2L 15864094..15864207 1..114 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:59:37 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RA 1..267 7..273 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:35:43 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RA 1..267 7..273 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:04:34 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RB 1..267 7..273 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:59:37 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RA 1..267 7..273 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:35:43 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RA 1..397 1..397 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:04:34 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
CG42792-RB 33..429 1..397 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:56:22 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15864968..15865250 115..397 100 <- Minus
2L 15865316..15865429 1..114 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:56:22 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15864968..15865250 115..397 100 <- Minus
2L 15865316..15865429 1..114 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:56:22 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15864968..15865250 115..397 100 <- Minus
2L 15865316..15865429 1..114 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:35:43 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15865316..15865429 1..114 100   Minus
arm_2L 15864968..15865250 115..397 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:37:04 Download gff for MIP22882.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15864968..15865250 115..397 100 <- Minus
2L 15865316..15865429 1..114 100   Minus

MIP22882.pep Sequence

Translation from 0 to 272

> MIP22882.pep
LKMSPKFALAVLLLSCVLLGLANAQYNRRYQTGPNRQKIGTRMNADGPLP
PNFPPPADNAGGSDVPANVDCMPNLLASNTLDTRKPRPKH*

MIP22882.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24190-PA 85 GG24190-PA 1..84 3..89 230 60 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG42792-PA 88 CG42792-PA 1..88 3..90 472 100 Plus
CG42792-PB 88 CG42792-PB 1..88 3..90 472 100 Plus
CG44475-PA 81 CG44475-PA 1..81 3..90 382 85.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17928-PA 88 GM17928-PA 1..88 3..90 357 90.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21934-PA 88 GD21934-PA 1..88 3..90 307 90.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19381-PA 71 GE19381-PA 1..70 21..89 156 65.7 Plus
Dyak\GE19384-PA 65 GE19384-PA 1..64 21..89 149 54.3 Plus
Dyak\GE19383-PA 62 GE19383-PA 1..61 21..89 132 50 Plus

MIP22882.hyp Sequence

Translation from 0 to 272

> MIP22882.hyp
LKMSPKFALAVLLLSCVLLGLANAQYNRRYQTGPNRQKIGTRMNADGPLP
PNFPPPADNAGGSDVPANVDCMPNLLASNTLDTRKPRPKH*

MIP22882.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG42792-PA 88 CG42792-PA 1..88 3..90 472 100 Plus
CG42792-PB 88 CG42792-PB 1..88 3..90 472 100 Plus
CG44475-PA 81 CG44475-PA 1..81 3..90 382 85.2 Plus