Clone MIP22927 Report

Search the DGRC for MIP22927

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:229
Well:27
Vector:pOT2
Associated Gene/TranscriptCG43450-RA
Protein status:MIP22927.pep: gold
Sequenced Size:299

Clone Sequence Records

MIP22927.complete Sequence

299 bp assembled on 2010-06-02

GenBank Submission: BT124964.1

> MIP22927.complete
CCGAAACCCTATAAACTACACAAAGTGAGAAGTAAGACGTTTGGAGAATG
AATCTTAGGAGGACGCCCTGCCCCCAATTAAACACCACCGCAACCACAAT
GAAGAAATGTGTAATTGCCTGTTCGTCTTTCGGTTCTCCGTCAACGTCGT
GCTGCTCTCATTGGCCACGATTATTCTCATCCTCCGCATGGTGAGCTGAT
CCAGGATGGGCGCGGGGATCCCCTTCCAGCCGACAAATTCTTGTTTCTTA
TTATCTTTTATAAAAAACCCTCACTAAGCGCAAAAAAAAAAAAAAAAAA

MIP22927.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:39:11 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:50:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8020679..8020959 1..281 1405 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12195294..12195583 1..290 1420 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11936125..11936414 1..290 1420 99.3 Plus
Blast to na_te.dros performed on 2019-03-16 18:50:33 has no hits.

MIP22927.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:51:36 Download gff for MIP22927.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8020679..8020959 1..281 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:51:34 Download gff for MIP22927.complete
Subject Subject Range Query Range Percent Splice Strand
CG43450-RA 1..147 48..194 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:51:52 Download gff for MIP22927.complete
Subject Subject Range Query Range Percent Splice Strand
CG43450-RA 1..147 48..194 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:34 Download gff for MIP22927.complete
Subject Subject Range Query Range Percent Splice Strand
CG43450-RA 1..281 1..281 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:51:52 Download gff for MIP22927.complete
Subject Subject Range Query Range Percent Splice Strand
CG43450-RA 1..281 1..281 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:36 Download gff for MIP22927.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12195294..12195574 1..281 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:36 Download gff for MIP22927.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12195294..12195574 1..281 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:36 Download gff for MIP22927.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12195294..12195574 1..281 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:34 Download gff for MIP22927.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8021016..8021296 1..281 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:37:13 Download gff for MIP22927.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11936125..11936405 1..281 100   Plus

MIP22927.pep Sequence

Translation from 47 to 193

> MIP22927.pep
MNLRRTPCPQLNTTATTMKKCVIACSSFGSPSTSCCSHWPRLFSSSAW*

MIP22927.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG43450-PA 48 CG43450-PA 1..48 1..48 271 100 Plus

MIP22927.hyp Sequence

Translation from 47 to 193

> MIP22927.hyp
MNLRRTPCPQLNTTATTMKKCVIACSSFGSPSTSCCSHWPRLFSSSAW*

MIP22927.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG43450-PA 48 CG43450-PA 1..48 1..48 271 100 Plus