MIP22927.complete Sequence
299 bp assembled on 2010-06-02
GenBank Submission: BT124964.1
> MIP22927.complete
CCGAAACCCTATAAACTACACAAAGTGAGAAGTAAGACGTTTGGAGAATG
AATCTTAGGAGGACGCCCTGCCCCCAATTAAACACCACCGCAACCACAAT
GAAGAAATGTGTAATTGCCTGTTCGTCTTTCGGTTCTCCGTCAACGTCGT
GCTGCTCTCATTGGCCACGATTATTCTCATCCTCCGCATGGTGAGCTGAT
CCAGGATGGGCGCGGGGATCCCCTTCCAGCCGACAAATTCTTGTTTCTTA
TTATCTTTTATAAAAAACCCTCACTAAGCGCAAAAAAAAAAAAAAAAAA
MIP22927.complete Blast Records
Blast to MB8.fasta performed on 2010-07-15 21:39:11 has no hits.
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:50:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 8020679..8020959 | 1..281 | 1405 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:50:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 12195294..12195583 | 1..290 | 1420 | 99.3 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:55:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 11936125..11936414 | 1..290 | 1420 | 99.3 | Plus |
Blast to na_te.dros performed on 2019-03-16 18:50:33 has no hits.
MIP22927.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:51:36 Download gff for
MIP22927.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 8020679..8020959 | 1..281 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:51:34 Download gff for
MIP22927.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43450-RA | 1..147 | 48..194 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:51:52 Download gff for
MIP22927.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43450-RA | 1..147 | 48..194 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:34 Download gff for
MIP22927.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43450-RA | 1..281 | 1..281 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:51:52 Download gff for
MIP22927.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43450-RA | 1..281 | 1..281 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:36 Download gff for
MIP22927.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12195294..12195574 | 1..281 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:36 Download gff for
MIP22927.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12195294..12195574 | 1..281 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:36 Download gff for
MIP22927.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12195294..12195574 | 1..281 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:34 Download gff for
MIP22927.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 8021016..8021296 | 1..281 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:37:13 Download gff for
MIP22927.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 11936125..11936405 | 1..281 | 100 | | Plus |
MIP22927.pep Sequence
Translation from 47 to 193
> MIP22927.pep
MNLRRTPCPQLNTTATTMKKCVIACSSFGSPSTSCCSHWPRLFSSSAW*
MIP22927.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43450-PA | 48 | CG43450-PA | 1..48 | 1..48 | 271 | 100 | Plus |
MIP22927.hyp Sequence
Translation from 47 to 193
> MIP22927.hyp
MNLRRTPCPQLNTTATTMKKCVIACSSFGSPSTSCCSHWPRLFSSSAW*
MIP22927.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43450-PA | 48 | CG43450-PA | 1..48 | 1..48 | 271 | 100 | Plus |