Clone MIP23504 Report

Search the DGRC for MIP23504

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:235
Well:4
Vector:pOT2
Associated Gene/TranscriptCG15047-RA
Protein status:MIP23504.pep: gold
Sequenced Size:919

Clone Sequence Records

MIP23504.complete Sequence

919 bp assembled on 2010-08-03

GenBank Submission: BT125075.1

> MIP23504.complete
CCAAAGTTGAGCTGCGGAAATGTCGCAAGTTGAGCAATTGCATCTGAAAT
CTCCGCCAGAAACGGCTGCAGCAGGAGCAGGATCTCCTCAAGCAGCCGCT
TCGGTGGCCGTGGCAGCCGATGCCAACGAAACGGAGCTCATGGTGAAGGT
GGTCATGGACATGGGCTATCCGGAGGGCGAGGCTCGCTTGGCGCTGGCCC
AGAGTAACAACAACGTGCAGCGGGCGGTGCAGATCTTGGTGGAGGGAATG
GATGACGGCGAGACGCGCAAAAGGCGTGGCAATCGCAAGCGATTAAGGCA
ACTGCGCAGCTCCCTCATGGGGAATCCACTTGCCACGGATGAAGCCATCA
TCGAGATGATGCGCGATCAGAGGATCGCACAGACGCTCGCCGAGTTGGTG
AACGGCAGCAGTGTGCAGGCCATGGAACTGCTACTGTCCGAGGAAGTGGA
TGAGTCCGAGAACGAGCAGCCGGAGGAGCAGGAGCTTGAAACCAGCCAGG
AGCAGTCATCCTCATCTGCCGATGACTCTTCGCCTAGCAACTGAAAGGGA
AACCAGATACTAGTTAGTACTGCTTACATCTTATAAGTTAAGGTATAGAT
ATATGAGAAGTTTAGTTTTCAAGTCTACTGTTAAGTTAAAACAAGTTCTT
CATAGTTACGTTTTTAGTTTGCTATTATGTTTAAAAAATGCCCTTAACTT
TATAGTAAGTGTATATCAGAGTAATTAATGTTGATATTAATCCACCATGA
AGTCTAACGAAGATTTCCATGTTAATTTTGTTAATTTTGTTTTCATATCT
AAAAAGTGTCATCAATTTAAAAGTATACTTATATTTTAGTTTATTTTCAA
TTGTGGAATTTCGTGAATATTTGCATTAAATATATTGCTAAGCTGTTAGT
GAAAAAAAAAAAAAAAAAA

MIP23504.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18417823..18418723 1..901 4475 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18528693..18529595 1..903 4515 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18536791..18537693 1..903 4515 100 Plus
Blast to na_te.dros performed 2019-03-15 14:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
jockey2 3428 jockey2 JOCKEY2 3428bp 3266..3336 887..811 110 64.9 Minus
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6314..6425 887..773 108 57.4 Minus

MIP23504.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:52:05 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18417823..18418723 1..901 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-03 12:38:30 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
CG15047-RA 1..525 20..544 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:49:50 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
CG15047-RA 1..525 20..544 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:45:51 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
CG15047-RA 1..525 20..544 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:11:45 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
CG15047-RA 1..525 20..544 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-03 12:38:30 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
CG15047-RA 1..525 20..544 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:49:49 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
CG15047-RA 5..581 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:45:51 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
CG15047-RA 11..911 1..901 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:11:45 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
CG15047-RA 11..911 1..901 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:05 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
X 18528693..18529593 1..901 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:05 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
X 18528693..18529593 1..901 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:52:05 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
X 18528693..18529593 1..901 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:45:51 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18422726..18423626 1..901 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:25:38 Download gff for MIP23504.complete
Subject Subject Range Query Range Percent Splice Strand
X 18536791..18537691 1..901 100   Plus

MIP23504.hyp Sequence

Translation from 19 to 543

> MIP23504.hyp
MSQVEQLHLKSPPETAAAGAGSPQAAASVAVAADANETELMVKVVMDMGY
PEGEARLALAQSNNNVQRAVQILVEGMDDGETRKRRGNRKRLRQLRSSLM
GNPLATDEAIIEMMRDQRIAQTLAELVNGSSVQAMELLLSEEVDESENEQ
PEEQELETSQEQSSSSADDSSPSN*

MIP23504.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG15047-PA 174 CG15047-PA 1..174 1..174 844 100 Plus

MIP23504.pep Sequence

Translation from 19 to 543

> MIP23504.pep
MSQVEQLHLKSPPETAAAGAGSPQAAASVAVAADANETELMVKVVMDMGY
PEGEARLALAQSNNNVQRAVQILVEGMDDGETRKRRGNRKRLRQLRSSLM
GNPLATDEAIIEMMRDQRIAQTLAELVNGSSVQAMELLLSEEVDESENEQ
PEEQELETSQEQSSSSADDSSPSN*

MIP23504.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22536-PA 178 GF22536-PA 1..136 1..136 276 57.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:01:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19172-PA 177 GG19172-PA 1..137 1..135 520 81.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:01:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12431-PA 212 GH12431-PA 103..210 45..145 149 35.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG15047-PA 174 CG15047-PA 1..174 1..174 844 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15024-PA 130 GI15024-PA 17..125 45..154 197 42.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26981-PA 164 GL26981-PA 3..163 10..174 261 39.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13458-PA 166 GA13458-PA 3..126 10..135 240 39.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22904-PA 174 GM22904-PA 1..139 1..139 597 92.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24855-PA 174 GD24855-PA 1..135 1..135 579 91.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15374-PA 154 GJ15374-PA 5..137 24..152 196 41.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16020-PA 145 GK16020-PA 3..102 37..135 186 45.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17733-PA 167 GE17733-PA 1..131 1..135 572 90.4 Plus