Clone MIP24381 Report

Search the DGRC for MIP24381

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:243
Well:81
Vector:pOT2
Protein status:MIP24381.pep: Imported from assembly
Sequenced Size:865

Clone Sequence Records

MIP24381.complete Sequence

865 bp assembled on 2010-08-11

GenBank Submission: BT125088.1

> MIP24381.complete
GTCGAATCAAGATCTCAGTCTGAGTTTAATCGTTATCCTGGCCGTAACTA
CGGTTGGTCAGGCCGCGCCTTCCATATCAAGGGTGGTCAATGGTACGGAC
TCCAGTGTGCTGAAATATCCTTTCGTGGTATCCCTAAGGAGCTACGATGG
CTCGCATTCCTGCGGTGGTTCTATTATTTCAAAACATTTTGTGATGACCG
CTGCTCATTGCACCAATGGTCGACCTGCGGATACCCTATCAATTCAGTTT
GGAGTGACCAATATTAGTGCCATGGGTCCGAATGTGGTGGGCATAAAGAA
GATAATCCAGCACGAAGACTTTGATCCCACTCGCCAAAATGCAAATGACA
TCTCGCTGCTGATGGTGGAGGAACCTTTTGAGTTCGATGGCGTCTCTGTG
GCCCCGGTGGAACTGCCAGCTCTGGCTTTTGCTGTGCCTCAATCGGATGC
TGGAGTCGAAGGAGTGCTCATCGGTTGGGGTCTCAATGATACTTATGGAA
GTGTGCAGGACACCCTACAGGAGGTTTCCCTGAAGATTTACTCGGATGAA
GAGTGCACCAGCCGGCACAATGGCCAAACGGATCCCAAATATCACATATG
CGGAGGAGTAGACGAAGGAGGAAAGGGACAGTGCAGTGGAGATTCGGGCG
GACCCCTCATCTACAATGGCCAGCAAGTGGGCATCGTGTCGTGGAGCATT
AAGCCCTGCACCGTGGCTCCCTATCCGGGTGTCTACTGTAAGGTTAGCCA
GTACGTTGACTGGATCAAAAGCAACCAAATCATATCGGCTTAGTCACAAA
GTATATTGTTCAATAAATTGAAAATTAAAGCACTTAATAAATAATCAAAA
AAAAAAAAAAAAAAA

MIP24381.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5154988..5155343 846..491 1780 100 Minus
chr3R 27901430 chr3R 5155406..5155769 490..127 1775 99.2 Minus
chr3R 27901430 chr3R 5156716..5156931 796..581 690 88 Minus
chr3R 27901430 chr3R 5155956..5156085 130..1 650 100 Minus
chr3R 27901430 chr3R 5157087..5157427 488..148 460 75.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9329641..9330004 490..127 1820 100 Minus
3R 32079331 3R 9329222..9329578 847..491 1785 100 Minus
3R 32079331 3R 9330951..9331166 796..581 690 88 Minus
3R 32079331 3R 9330191..9330320 130..1 650 100 Minus
3R 32079331 3R 9331322..9331662 488..148 445 75.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9070472..9070835 490..127 1820 100 Minus
3R 31820162 3R 9070053..9070409 847..491 1785 100 Minus
3R 31820162 3R 9071782..9071997 796..581 690 87.9 Minus
3R 31820162 3R 9071022..9071151 130..1 650 100 Minus
3R 31820162 3R 9072313..9072398 328..243 220 83.7 Minus
3R 31820162 3R 9072431..9072493 210..148 210 88.8 Minus
3R 31820162 3R 9072153..9072204 488..437 155 86.5 Minus
Blast to na_te.dros performed 2019-03-15 20:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 4550..4581 818..787 115 84.4 Minus

MIP24381.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:50:48 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5154988..5155343 491..846 100 <- Minus
chr3R 5155406..5155768 128..490 99 <- Minus
chr3R 5155959..5156085 1..127 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-11 16:05:40 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
CG12951-RA 6..798 1..793 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:50:06 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
CG12951-RA 6..798 1..793 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:24:41 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
CG12951-RA 6..798 1..793 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:52 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
CG12951-RA 6..798 1..793 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-11 16:05:40 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
CG12951-RA 6..798 1..793 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:50:06 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
CG12951-RA 6..798 1..793 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:24:41 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
CG12951-RA 12..857 1..846 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:52 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
CG12951-RA 12..857 1..846 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:48 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9330194..9330320 1..127 100   Minus
3R 9329223..9329578 491..846 100 <- Minus
3R 9329641..9330003 128..490 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:48 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9330194..9330320 1..127 100   Minus
3R 9329223..9329578 491..846 100 <- Minus
3R 9329641..9330003 128..490 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:48 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9330194..9330320 1..127 100   Minus
3R 9329223..9329578 491..846 100 <- Minus
3R 9329641..9330003 128..490 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:24:41 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5154945..5155300 491..846 100 <- Minus
arm_3R 5155363..5155725 128..490 100 <- Minus
arm_3R 5155916..5156042 1..127 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:25:57 Download gff for MIP24381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9070054..9070409 491..846 100 <- Minus
3R 9070472..9070834 128..490 100 <- Minus
3R 9071025..9071151 1..127 100   Minus

MIP24381.hyp Sequence

Translation from 0 to 792

> MIP24381.hyp
SNQDLSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDG
SHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKK
IIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDA
GVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHIC
GGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQ
YVDWIKSNQIISA*

MIP24381.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG12951-PA 265 CG12951-PA 3..265 1..263 1378 100 Plus
CG16749-PA 265 CG16749-PA 4..265 2..263 1086 76.3 Plus
CG32808-PA 284 CG32808-PA 29..255 27..255 499 44.8 Plus
etaTry-PA 262 CG12386-PA 9..254 7..255 376 35 Plus
lambdaTry-PA 272 CG12350-PA 35..256 27..255 371 36.6 Plus

MIP24381.pep Sequence

Translation from 1 to 792

> MIP24381.pep
SNQDLSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDG
SHSCGGSIISKHFVMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKK
IIQHEDFDPTRQNANDISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDA
GVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEECTSRHNGQTDPKYHIC
GGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQ
YVDWIKSNQIISA*

MIP24381.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17773-PA 263 GF17773-PA 4..262 2..260 1142 79.9 Plus
Dana\GF17772-PA 266 GF17772-PA 4..266 2..263 1049 73.8 Plus
Dana\GF21275-PA 281 GF21275-PA 4..252 6..255 508 42.5 Plus
Dana\GF11616-PA 379 GF11616-PA 132..363 26..257 359 35.8 Plus
Dana\GF14668-PA 279 GF14668-PA 52..276 27..258 355 37.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17384-PA 266 GG17384-PA 3..258 1..256 1245 91.4 Plus
Dere\GG17383-PA 266 GG17383-PA 4..266 2..263 1035 73 Plus
Dere\GG12696-PA 281 GG12696-PA 3..252 6..255 517 43.9 Plus
Dere\GG20743-PA 372 GG20743-PA 125..356 26..257 368 36.2 Plus
Dere\GG24433-PA 277 GG24433-PA 50..274 27..258 354 37.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22349-PA 262 GH22349-PA 19..262 21..263 908 68.9 Plus
Dgri\GH24469-PA 312 GH24469-PA 49..277 28..255 504 44.5 Plus
Dgri\GH22868-PA 268 GH22868-PA 32..265 27..259 355 33.6 Plus
Dgri\GH22923-PA 266 GH22923-PA 31..254 27..259 353 36.3 Plus
Dgri\GH22866-PA 255 GH22866-PA 8..251 5..258 350 35.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG12951-PA 265 CG12951-PA 3..265 1..263 1378 100 Plus
CG16749-PA 265 CG16749-PA 4..265 2..263 1086 76.3 Plus
CG32808-PA 284 CG32808-PA 29..255 27..255 499 44.8 Plus
etaTry-PA 262 CG12386-PA 9..254 7..255 376 35 Plus
lambdaTry-PA 272 CG12350-PA 35..256 27..255 371 36.6 Plus
CG4386-PA 372 CG4386-PA 126..356 27..257 360 36.4 Plus
CG8299-PA 260 CG8299-PA 5..253 5..256 354 34.2 Plus
CG31954-PA 277 CG31954-PA 50..274 27..258 352 36.9 Plus
CG5255-PA 273 CG5255-PA 28..256 26..262 349 35.1 Plus
CG3355-PA 314 CG3355-PA 71..305 23..258 328 34.8 Plus
CG18735-PA 364 CG18735-PA 82..314 27..258 327 34 Plus
CG11836-PI 281 CG11836-PI 44..273 27..258 324 33.8 Plus
CG11836-PJ 333 CG11836-PJ 96..325 27..258 324 33.8 Plus
CG9294-PB 352 CG9294-PB 97..337 24..258 321 31.9 Plus
CG17571-PB 258 CG17571-PB 4..251 5..255 320 30.9 Plus
CG17571-PA 258 CG17571-PA 4..251 5..255 320 30.9 Plus
Try29F-PD 267 CG9564-PD 41..263 27..257 318 36.9 Plus
Try29F-PC 267 CG9564-PC 41..263 27..257 318 36.9 Plus
CG1304-PA 260 CG1304-PA 12..256 8..258 317 32.8 Plus
kappaTry-PC 263 CG12388-PC 3..254 5..256 317 29.5 Plus
CG31265-PA 266 CG31265-PA 4..256 5..257 307 33 Plus
Ser6-PA 259 CG2071-PA 12..256 6..258 305 32.6 Plus
CG11836-PF 223 CG11836-PF 6..215 48..258 302 34.2 Plus
CG11836-PE 223 CG11836-PE 6..215 48..258 302 34.2 Plus
CG11836-PG 223 CG11836-PG 6..215 48..258 302 34.2 Plus
CG11836-PC 223 CG11836-PC 6..215 48..258 302 34.2 Plus
CG11836-PA 223 CG11836-PA 6..215 48..258 302 34.2 Plus
CG11836-PB 223 CG11836-PB 6..215 48..258 302 34.2 Plus
alphaTry-PA 256 CG18444-PA 2..251 7..257 300 30.4 Plus
Ser8-PA 260 CG4812-PA 12..257 5..259 299 32.9 Plus
Jon25Bi-PB 266 CG8867-PB 36..260 27..258 298 37.7 Plus
betaTry-PB 253 CG18211-PB 30..252 27..258 297 32.6 Plus
betaTry-PA 253 CG18211-PA 30..252 27..258 297 32.6 Plus
gammaTry-PA 253 CG30028-PA 30..252 27..258 294 32.8 Plus
deltaTry-PA 253 CG12351-PA 30..252 27..258 294 32.8 Plus
CG30031-PA 253 CG30031-PA 30..252 27..258 294 32.8 Plus
epsilonTry-PA 256 CG18681-PA 7..250 9..256 294 32.4 Plus
CG7829-PA 253 CG7829-PA 27..245 27..255 293 30.9 Plus
zetaTry-PA 280 CG12387-PA 38..273 27..255 293 30.9 Plus
CG30025-PA 253 CG30025-PA 30..252 27..258 291 32.3 Plus
CG6041-PA 308 CG6041-PA 23..269 13..255 291 32.2 Plus
CG9676-PA 251 CG9676-PA 7..245 8..255 290 34.8 Plus
l(2)k05911-PC 639 CG31728-PC 395..637 23..258 290 32.4 Plus
CG31269-PB 273 CG31269-PB 37..257 27..257 289 34.1 Plus
CG5246-PA 272 CG5246-PA 33..262 18..256 287 34.6 Plus
Jon44E-PB 271 CG8579-PB 40..266 27..258 286 35.3 Plus
Jon44E-PA 271 CG8579-PA 40..266 27..258 286 35.3 Plus
iotaTry-PA 252 CG7754-PA 10..245 12..255 284 32.1 Plus
CG17477-PA 267 CG17477-PA 27..248 28..256 283 33.2 Plus
CG13430-PB 267 CG13430-PB 5..259 4..255 282 30.4 Plus
CG13430-PA 267 CG13430-PA 5..259 4..255 282 30.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23606-PA 264 GI23606-PA 23..264 21..263 911 69.1 Plus
Dmoj\GI16486-PA 321 GI16486-PA 64..291 27..256 505 42.9 Plus
Dmoj\GI17775-PA 275 GI17775-PA 48..272 27..258 385 39.4 Plus
Dmoj\GI17776-PA 280 GI17776-PA 48..277 27..258 362 38.8 Plus
Dmoj\GI23805-PA 280 GI23805-PA 11..277 5..258 351 34.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13734-PA 265 GL13734-PA 17..265 15..263 1005 73.1 Plus
Dper\GL14376-PA 282 GL14376-PA 9..251 10..255 471 43.8 Plus
Dper\GL20660-PA 260 GL20660-PA 5..255 5..258 348 33.2 Plus
Dper\GL17516-PA 377 GL17516-PA 130..361 26..257 346 34.2 Plus
Dper\GL17342-PA 280 GL17342-PA 35..273 27..258 343 36.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14124-PA 265 GA14124-PA 17..265 15..263 1002 72.7 Plus
Dpse\GA18150-PA 375 GA18150-PA 128..359 26..257 346 34.2 Plus
Dpse\GA20967-PA 260 GA20967-PA 5..255 5..258 344 33.6 Plus
Dpse\GA11599-PA 280 GA11599-PA 35..273 27..258 343 36.1 Plus
Dpse\GA11574-PA 269 GA11574-PA 35..253 27..255 341 36.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26269-PA 265 GM26269-PA 4..265 2..263 1060 73.7 Plus
Dsec\GM26270-PA 207 GM26270-PA 3..207 1..263 929 73.4 Plus
Dsec\GM18971-PA 287 GM18971-PA 16..255 14..255 507 42.9 Plus
Dsec\GM15686-PA 372 GM15686-PA 125..356 26..257 360 35.8 Plus
Dsec\GM18144-PA 277 GM18144-PA 50..274 27..258 351 36.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20806-PA 265 GD20806-PA 3..265 1..263 1348 97 Plus
Dsim\GD20805-PA 265 GD20805-PA 4..265 2..263 1034 76 Plus
Dsim\GD24635-PA 281 GD24635-PA 16..252 23..255 445 40.9 Plus
Dsim\GD25165-PA 372 GD25165-PA 125..356 26..257 360 35.8 Plus
Dsim\GD10792-PA 272 GD10792-PA 36..256 28..255 352 37.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23580-PA 265 GJ23580-PA 23..265 21..263 984 72.8 Plus
Dvir\GJ16031-PA 289 GJ16031-PA 6..255 7..255 475 43.1 Plus
Dvir\GJ21494-PA 265 GJ21494-PA 30..253 27..259 368 37 Plus
Dvir\GJ20854-PA 260 GJ20854-PA 5..255 5..258 344 32 Plus
Dvir\GJ17600-PA 276 GJ17600-PA 49..273 27..258 344 35.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11729-PA 267 GK11729-PA 3..267 1..263 1026 71.3 Plus
Dwil\GK15652-PA 366 GK15652-PA 119..350 26..257 353 35.4 Plus
Dwil\GK19691-PA 259 GK19691-PA 2..243 9..255 339 35.2 Plus
Dwil\GK14673-PA 280 GK14673-PA 53..277 27..258 338 37.3 Plus
Dwil\GK22084-PA 261 GK22084-PA 2..256 2..258 333 34.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24788-PA 265 GE24788-PA 3..265 1..263 1306 91.6 Plus
Dyak\GE24786-PA 266 GE24786-PA 4..266 2..263 1036 76.4 Plus
Dyak\GE16525-PA 281 GE16525-PA 26..252 27..255 505 44.8 Plus
Dyak\GE12880-PA 272 GE12880-PA 35..256 27..255 360 37.5 Plus
Dyak\GE13675-PA 378 GE13675-PA 131..362 26..257 360 35.8 Plus