Clone MIP24405 Report

Search the DGRC for MIP24405

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:244
Well:5
Vector:pOT2
Associated Gene/TranscriptNpc2e-RB
Protein status:MIP24405.pep: gold
Sequenced Size:701

Clone Sequence Records

MIP24405.complete Sequence

701 bp assembled on 2010-08-11

GenBank Submission: BT125107.1

> MIP24405.complete
TGCGCGCGTACTCAATGTATATTGTATTCTTCTGAAGTAAGATTAAAAAA
GATTCCATCCAGAAAAATGCTGCGAATCGTTGTAACTTTGGCTCTAATTC
TGGCCACAGTCAATGCCACCAATGTCCAGCAGTGCAAAAATAAGCCGTTT
CCACTGGATGTGAATATTAAGGATTGCGAGGAACCGCCGTGCGTTGTGTA
CAAAGGAACCATAGCAGTCATGGAGGTGCACTTCCTGGGCAATAACAACA
ATATCAAGAGCATTACGGCCACCACAACGGCAAAGGTTTTGGGCATGAAT
CTGCCATATGCCCTACCCGACGAAGTGTCCGATGTGTGCCGCAATCTCCT
GTACGGTGCCATCTGTCCCATCGACAAGGACGAGGATGTCACGTATCAGT
TCAACTTCTATGTGGAGCCTTCGTTCCCGGAAATAACGGCGGATGTCACT
GTCACGTTGAACGATGCGCAGAACGAACCGATCACCTGCTTCGTCGTGAG
CTGTAAAATCCGGAAGGGAGCCACTGCAGCACAGATGGACGGATATCTGT
TGGACTGGACGAACCCCCTTTAAGCCGACGATGTACGCAACTCCAGCCGT
TTCGGCCGACTGAATATTTCCACTTGTTTGCCAAATAATAAACCACAAAA
CTCTTGCACAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
A

MIP24405.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5879698..5880117 242..661 2100 100 Plus
chr3R 27901430 chr3R 5879101..5879234 1..134 670 100 Plus
chr3R 27901430 chr3R 5879532..5879643 134..245 545 99.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10053929..10054349 242..662 2105 100 Plus
3R 32079331 3R 10053332..10053465 1..134 670 100 Plus
3R 32079331 3R 10053763..10053874 134..245 545 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9794760..9795180 242..662 2105 100 Plus
3R 31820162 3R 9794163..9794296 1..134 670 100 Plus
3R 31820162 3R 9794594..9794705 134..245 545 99.1 Plus
Blast to na_te.dros performed on 2019-03-15 20:50:19 has no hits.

MIP24405.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:51:02 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5879101..5879233 1..133 100 -> Plus
chr3R 5879532..5879639 134..241 100 -> Plus
chr3R 5879698..5880117 242..661 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-11 17:15:38 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
CG31410-RB 1..507 67..573 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:50:33 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2e-RB 1..507 67..573 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:25:13 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2e-RB 1..507 67..573 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:32:16 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2e-RB 1..507 67..573 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-11 17:15:38 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
CG31410-RB 1..507 67..573 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:50:32 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2e-RB 1..507 67..573 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:25:13 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2e-RB 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:32:16 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
Npc2e-RB 1..661 1..661 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:51:02 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10053332..10053464 1..133 100 -> Plus
3R 10053763..10053870 134..241 100 -> Plus
3R 10053929..10054348 242..661 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:51:02 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10053332..10053464 1..133 100 -> Plus
3R 10053763..10053870 134..241 100 -> Plus
3R 10053929..10054348 242..661 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:51:02 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10053332..10053464 1..133 100 -> Plus
3R 10053763..10053870 134..241 100 -> Plus
3R 10053929..10054348 242..661 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:25:13 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5879054..5879186 1..133 100 -> Plus
arm_3R 5879485..5879592 134..241 100 -> Plus
arm_3R 5879651..5880070 242..661 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:26:27 Download gff for MIP24405.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9794760..9795179 242..661 100   Plus
3R 9794163..9794295 1..133 100 -> Plus
3R 9794594..9794701 134..241 100 -> Plus

MIP24405.hyp Sequence

Translation from 0 to 572

> MIP24405.hyp
CARTQCILYSSEVRLKKIPSRKMLRIVVTLALILATVNATNVQQCKNKPF
PLDVNIKDCEEPPCVVYKGTIAVMEVHFLGNNNNIKSITATTTAKVLGMN
LPYALPDEVSDVCRNLLYGAICPIDKDEDVTYQFNFYVEPSFPEITADVT
VTLNDAQNEPITCFVVSCKIRKGATAAQMDGYLLDWTNPL*

MIP24405.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2e-PB 168 CG31410-PB 1..168 23..190 887 100 Plus
Npc2d-PA 173 CG12813-PA 7..173 26..188 272 38 Plus
Npc2c-PA 165 CG3934-PA 3..164 20..176 270 35.8 Plus

MIP24405.pep Sequence

Translation from 0 to 572

> MIP24405.pep
CARTQCILYSSEVRLKKIPSRKMLRIVVTLALILATVNATNVQQCKNKPF
PLDVNIKDCEEPPCVVYKGTIAVMEVHFLGNNNNIKSITATTTAKVLGMN
LPYALPDEVSDVCRNLLYGAICPIDKDEDVTYQFNFYVEPSFPEITADVT
VTLNDAQNEPITCFVVSCKIRKGATAAQMDGYLLDWTNPL*

MIP24405.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17854-PA 164 GF17854-PA 1..163 23..184 690 81.6 Plus
Dana\GF17855-PA 170 GF17855-PA 7..170 23..185 642 73.8 Plus
Dana\GF17136-PA 175 GF17136-PA 7..169 26..180 265 41 Plus
Dana\GF17856-PA 164 GF17856-PA 4..164 15..176 262 34.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17324-PA 168 GG17324-PA 1..167 23..189 841 93.4 Plus
Dere\GG17335-PA 165 GG17335-PA 1..165 18..177 262 33.9 Plus
Dere\GG17305-PA 172 GG17305-PA 25..172 39..188 260 40.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14243-PA 293 GH14243-PA 150..287 47..185 489 64 Plus
Dgri\GH14070-PA 149 GH14070-PA 3..149 39..185 279 43 Plus
Dgri\GH14244-PA 204 GH14244-PA 16..162 32..173 273 40.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
Npc2e-PB 168 CG31410-PB 1..168 23..190 887 100 Plus
Npc2d-PA 173 CG12813-PA 7..173 26..188 272 38 Plus
Npc2c-PA 165 CG3934-PA 3..164 20..176 270 35.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23136-PA 169 GI23136-PA 1..155 23..176 553 66.5 Plus
Dmoj\GI23137-PA 162 GI23137-PA 12..162 26..173 276 37.5 Plus
Dmoj\GI24446-PA 175 GI24446-PA 4..175 25..188 264 35.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27202-PA 172 GL27202-PA 1..163 23..186 658 76.2 Plus
Dper\GL27280-PA 162 GL27280-PA 7..158 26..173 274 43.9 Plus
Dper\GL27203-PA 164 GL27203-PA 9..160 26..172 246 34.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16235-PA 172 GA16235-PA 1..165 23..188 642 73.5 Plus
Dpse\GA11826-PA 162 GA11826-PA 24..158 39..173 270 44.5 Plus
Dpse\GA17784-PA 164 GA17784-PA 9..160 26..172 246 34.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23854-PA 168 GM23854-PA 1..168 23..190 843 94 Plus
Dsec\GM18752-PA 165 GM18752-PA 1..164 18..176 270 34.8 Plus
Dsec\GM26189-PA 169 GM26189-PA 26..160 39..173 255 42.3 Plus
Dsec\GM19612-PA 140 GM19612-PA 10..139 49..176 248 37.7 Plus
Dsec\GM23855-PA 95 GM23855-PA 1..94 85..176 169 36.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18662-PA 168 GD18662-PA 1..168 23..190 866 97.6 Plus
Dsim\GD11029-PA 792 GD11029-PA 646..792 44..190 781 95.9 Plus
Dsim\GD18663-PA 165 GD18663-PA 1..164 18..176 266 34.1 Plus
Dsim\GD20738-PA 172 GD20738-PA 25..172 39..188 261 40.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10437-PA 135 GJ10437-PA 1..115 74..189 441 72.4 Plus
Dvir\GJ10723-PA 176 GJ10723-PA 29..176 39..188 286 42.1 Plus
Dvir\GJ10438-PA 162 GJ10438-PA 22..161 37..172 261 37.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10874-PA 169 GK10874-PA 1..165 23..186 656 72.9 Plus
Dwil\GK10875-PA 153 GK10875-PA 1..151 23..172 495 61.6 Plus
Dwil\GK12205-PA 172 GK12205-PA 5..172 24..188 275 40.1 Plus
Dwil\GK12204-PA 172 GK12204-PA 25..172 39..188 263 40.8 Plus
Dwil\GK10876-PA 163 GK10876-PA 11..159 26..172 240 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26005-PA 168 GE26005-PA 1..166 23..188 837 94 Plus
Dyak\GE24707-PA 172 GE24707-PA 25..172 39..188 268 40.8 Plus
Dyak\GE26006-PA 165 GE26006-PA 1..165 18..177 262 35.2 Plus