Clone MIP24488 Report

Search the DGRC for MIP24488

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:244
Well:88
Vector:pOT2
Protein status:MIP24488.pep: Imported from assembly
Sequenced Size:924

Clone Sequence Records

MIP24488.complete Sequence

924 bp assembled on 2010-08-11

GenBank Submission: BT125105.1

> MIP24488.complete
TGAAGAGCCAACCCATCCTGATTCTGGCCGTGTGCCTCTTGGCCCTCTCC
GCCGTTTCCGCCATGCCACAGCGTCGGGCGAAGAGTCAACGCCAGGTGGA
GTACTCATCCACACCCTATCCGGCTGCTGGCTTCCGCCCCAGGGTTCCCT
TTAATCTGCCCGGTGAAGTTCAACCCAAGATCGAGACGGAACCACTGACC
ACCACCAGTACCACGTCTGCCAGCGAAGTGGAAACCCTGGAGAATACCGA
GCCACTTAGCACCACCGAGCAGCAGCAGCCGGAAGCGGGAACGGTAGCGG
ATTTGGAATTGTCCATCCGCACGCCTGCCAATACCTACGGAGCCCCTGAA
GAGCAGGATCCCCTCGTGCCGGACACCGTAGTGGTGGTGGCCCAGGAGCC
AGCCCGCGACTTTCAGCCCCCCTCCCTGGATGCCGTCGAGGACTTTGCCG
CCGATGTCACTGTTGCTGCTGATGGCGAGCAGCCTGTTGCTGATGTCCCT
GCCCTGGGCCAAGCGGAGTCGGAGGACGATGAGCCCGAGGCGGCGGTCAA
GGCTGTCACCCCGGCTGGAGCCTATGGACCACCCGCCGCCACCTACGGTG
TGCCTGAGCTGAGCGAGACCGAGAACGAGTTGGATCTGGAGGAGTCGCAA
GTTGAGCTGGTTGAAGAGGAGGCGGCGGCGGAGGAGGCGCTGACCAACGA
GCTCTCTAGTGGTCGCCTGATCCTCCTGCCCTTGGGCGCCAGGGGAACAC
AGTTTGGTCGCCTCATCCTTGCCGTGGAGCAACCACGCCAGCGCCTGAGG
AGCGAACGACTCAGGCGGATTTAGGGCTTTACTTGCTTGTCCACGTGTGT
GGAATATTTGAACGAAAATATACGTACTTGTTTCTACGGAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAA

MIP24488.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21746093..21746981 1..889 4445 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21757158..21758048 1..891 4455 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21750258..21751148 1..891 4455 100 Plus
Blast to na_te.dros performed 2019-03-16 07:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6781..6837 502..446 114 66.7 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 119..208 509..414 114 66.7 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9149..9238 509..414 114 66.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6783 502..446 112 70 Minus

MIP24488.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:24:15 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21746093..21746981 1..889 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-11 17:10:12 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14564-RA 2..825 1..824 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:50:30 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14564-RA 2..825 1..824 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:51 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14564-RA 2..825 1..824 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:32:09 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14564-RA 2..825 1..824 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-11 17:10:12 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14564-RA 2..825 1..824 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:50:30 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14564-RA 2..825 1..824 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:51 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14564-RA 2..890 1..889 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:32:09 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
CG14564-RA 2..890 1..889 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:24:15 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21757158..21758046 1..889 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:24:15 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21757158..21758046 1..889 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:24:15 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21757158..21758046 1..889 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:51 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21750258..21751146 1..889 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:26:24 Download gff for MIP24488.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21750258..21751146 1..889 100   Plus

MIP24488.hyp Sequence

Translation from 2 to 823

> MIP24488.hyp
KSQPILILAVCLLALSAVSAMPQRRAKSQRQVEYSSTPYPAAGFRPRVPF
NLPGEVQPKIETEPLTTTSTTSASEVETLENTEPLSTTEQQQPEAGTVAD
LELSIRTPANTYGAPEEQDPLVPDTVVVVAQEPARDFQPPSLDAVEDFAA
DVTVAADGEQPVADVPALGQAESEDDEPEAAVKAVTPAGAYGPPAATYGV
PELSETENELDLEESQVELVEEEAAAEEALTNELSSGRLILLPLGARGTQ
FGRLILAVEQPRQRLRSERLRRI*

MIP24488.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG14564-PA 274 CG14564-PA 2..274 1..273 1357 100 Plus

MIP24488.pep Sequence

Translation from 2 to 823

> MIP24488.pep
KSQPILILAVCLLALSAVSAMPQRRAKSQRQVEYSSTPYPAAGFRPRVPF
NLPGEVQPKIETEPLTTTSTTSASEVETLENTEPLSTTEQQQPEAGTVAD
LELSIRTPANTYGAPEEQDPLVPDTVVVVAQEPARDFQPPSLDAVEDFAA
DVTVAADGEQPVADVPALGQAESEDDEPEAAVKAVTPAGAYGPPAATYGV
PELSETENELDLEESQVELVEEEAAAEEALTNELSSGRLILLPLGARGTQ
FGRLILAVEQPRQRLRSERLRRI*

MIP24488.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:06:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25168-PA 285 GF25168-PA 2..285 1..273 901 73.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16222-PA 268 GG16222-PA 2..268 1..268 945 86.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16372-PA 298 GH16372-PA 7..279 7..263 564 54 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14564-PA 274 CG14564-PA 2..274 1..273 1357 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11563-PA 288 GI11563-PA 7..284 8..271 546 55.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24861-PA 219 GL24861-PA 4..219 76..273 573 67 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13083-PA 286 GA13083-PA 21..286 21..273 744 69 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22405-PA 269 GM22405-PA 2..269 1..273 1077 93.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14996-PA 273 GD14996-PA 2..273 1..273 1094 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11243-PA 286 GJ11243-PA 7..269 7..263 597 57 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17062-PA 289 GK17062-PA 3..289 2..273 621 55.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23035-PA 271 GE23035-PA 2..259 1..261 1068 89.3 Plus
Dyak\GE19790-PA 271 GE19790-PA 2..259 1..261 1037 88.9 Plus