Clone MIP24490 Report

Search the DGRC for MIP24490

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:244
Well:90
Vector:pOT2
Associated Gene/TranscriptOsi8-RA
Protein status:MIP24490.pep: gold
Sequenced Size:1152

Clone Sequence Records

MIP24490.complete Sequence

1152 bp assembled on 2010-08-11

GenBank Submission: BT125106.1

> MIP24490.complete
AGCAGCGCCCGGCGTCATCTCCCCAGTGTATGCCTCAGCTCAAGGATCGC
CCAAGGATCCTTATCTCGTCCAGCGTCCAACAGCAATACCCAGCACAGTC
ATGATCAAGTACGTGTGGCATGTGGCTGCTCTGATGATCGTCTTCTGTTG
GCTCTCCAGTGCCCGCAGTGCCAGCTACCAGCATCAGAACCCGAACAGTC
TGAGCTCGGCCCCCAGGCCCCAAGTCCAAAACAGTAACCCCGGAATGGGG
TCTACGGGCTTGTGGAAGGACATGTCAATGGTCTACCGCATATACCAGCA
GTGCTCGGGCGATAACATGTCCGTTTGCCTAAAGGTCAAACTGCTAACCG
GCTTGGAGAAGGCCTTTCGATCGGCAAAGTCTCTCTCGCTCATGGAGGGC
ATTCAGTTCGTCAGTTCTGGTGGAGAAAGTGAGGAGACCAAAAGAGCGCC
CATTAGCGAAAAGGATATTGAAGCCGTCTTGCCGAGAAGTGTGGACGCCA
AGGAGCAGGTCCTAAACAACATGATCCTGAAGCGGGTGGGCAACTTCCTA
CAGGATCACACGCTACAGGTGAAATTCGATAACGAGGCAAATTCGGTGGA
GGGTCGCAAGAAAAAGGAGAAGAAGGGCAACGGCGCAATGATCATGATTC
CCCTTCTGCTTGGCGGCACCATTGTGCCCCTGGCCTACGGAGCCTTGGCC
ATGTTGGCGGGAAAGGCGCTGATTGTGTCCAAGCTGGCCCTGGTGCTGGC
CTCGATCATCGGAATCAAGAAGCTGCTGAGTGGAGGCGGCGGCGGGAAGG
AGTCCTCCCACGAGGTGGTCGTCTCCTCAGGAGGACATTCCGGCTGGGGT
CGGGAGCTGGACACCGCCTACAGCGGCTGGAAGCCGGCGGCCAAGGAGTC
GGCGGGCAGCGCCAAGAGCCTGTGAGCTCGCATTTGCATTTGGAAACAGA
AGTATCTCCTAGAAGGGAGATTCTCGGGAGATTATCGTGGAGAGTGAACC
AAAGAATCGAGCGCCGCAAGAACTGTCTGACTAATGTCTAGTTTAATTCG
CCTTATCGATCCTTAATTTAACGAACTAAATGTGTGTGTTAGGTTTAAGT
AAGCCCTAATTAAATATAGTAAATTCTGCTACCCGAAAAAAAAAAAAAAA
AA

MIP24490.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2080827..2081398 1..572 2860 100 Plus
chr3R 27901430 chr3R 2081685..2082254 566..1135 2850 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6256033..6256605 566..1138 2865 100 Plus
3R 32079331 3R 6255175..6255746 1..572 2860 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5996864..5997436 566..1138 2865 100 Plus
3R 31820162 3R 5996006..5996577 1..572 2860 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:18:29 has no hits.

MIP24490.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:19:10 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2080827..2081394 1..568 100 -> Plus
chr3R 2081688..2082254 569..1135 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-11 17:12:54 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
Osi8-RA 1..825 101..925 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:50:31 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
Osi8-RA 1..825 101..925 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:37:43 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
Osi8-RA 1..825 101..925 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:47 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
Osi8-RA 1..825 101..925 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-11 17:12:54 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
Osi8-RA 1..825 101..925 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:50:31 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
Osi8-RA 1..825 101..925 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:37:43 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
Osi8-RA 1..1135 1..1135 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:47 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
Osi8-RA 1..1135 1..1135 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:19:10 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6255175..6255742 1..568 100 -> Plus
3R 6256036..6256602 569..1135 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:19:10 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6255175..6255742 1..568 100 -> Plus
3R 6256036..6256602 569..1135 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:19:10 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6255175..6255742 1..568 100 -> Plus
3R 6256036..6256602 569..1135 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:37:43 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2080897..2081464 1..568 100 -> Plus
arm_3R 2081758..2082324 569..1135 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:26:25 Download gff for MIP24490.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5996006..5996573 1..568 100 -> Plus
3R 5996867..5997433 569..1135 100   Plus

MIP24490.hyp Sequence

Translation from 0 to 924

> MIP24490.hyp
AAPGVISPVYASAQGSPKDPYLVQRPTAIPSTVMIKYVWHVAALMIVFCW
LSSARSASYQHQNPNSLSSAPRPQVQNSNPGMGSTGLWKDMSMVYRIYQQ
CSGDNMSVCLKVKLLTGLEKAFRSAKSLSLMEGIQFVSSGGESEETKRAP
ISEKDIEAVLPRSVDAKEQVLNNMILKRVGNFLQDHTLQVKFDNEANSVE
GRKKKEKKGNGAMIMIPLLLGGTIVPLAYGALAMLAGKALIVSKLALVLA
SIIGIKKLLSGGGGGKESSHEVVVSSGGHSGWGRELDTAYSGWKPAAKES
AGSAKSL*

MIP24490.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
Osi8-PA 274 CG15591-PA 1..274 34..307 1388 100 Plus
Osi12-PA 295 CG1154-PA 50..247 96..302 268 34 Plus
Osi11-PA 302 CG15596-PA 26..288 77..295 228 28.1 Plus
Osi7-PA 288 CG1153-PA 43..285 97..295 220 26.1 Plus
Osi14-PA 268 CG1155-PA 48..250 104..307 215 29.7 Plus

MIP24490.pep Sequence

Translation from 1 to 924

> MIP24490.pep
AAPGVISPVYASAQGSPKDPYLVQRPTAIPSTVMIKYVWHVAALMIVFCW
LSSARSASYQHQNPNSLSSAPRPQVQNSNPGMGSTGLWKDMSMVYRIYQQ
CSGDNMSVCLKVKLLTGLEKAFRSAKSLSLMEGIQFVSSGGESEETKRAP
ISEKDIEAVLPRSVDAKEQVLNNMILKRVGNFLQDHTLQVKFDNEANSVE
GRKKKEKKGNGAMIMIPLLLGGTIVPLAYGALAMLAGKALIVSKLALVLA
SIIGIKKLLSGGGGGKESSHEVVVSSGGHSGWGRELDTAYSGWKPAAKES
AGSAKSL*

MIP24490.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16380-PA 273 GF16380-PA 1..273 34..307 1186 87.3 Plus
Dana\GF16383-PA 295 GF16383-PA 8..215 39..259 237 31.4 Plus
Dana\GF18624-PA 305 GF18624-PA 27..297 77..301 231 29.3 Plus
Dana\GF16386-PA 267 GF16386-PA 48..211 104..263 202 32.1 Plus
Dana\GF16388-PA 277 GF16388-PA 28..233 75..280 200 28.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13155-PA 274 GG13155-PA 1..274 34..307 1299 94.9 Plus
Dere\GG10544-PA 302 GG10544-PA 37..297 91..304 236 29.4 Plus
Dere\GG13181-PA 295 GG13181-PA 48..216 94..259 207 34.5 Plus
Dere\GG13215-PA 268 GG13215-PA 48..207 104..259 198 32.7 Plus
Dere\GG13248-PA 278 GG13248-PA 62..233 108..280 187 29.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14024-PA 281 GH14024-PA 1..281 34..307 949 73 Plus
Dgri\GH14282-PA 326 GH14282-PA 31..299 77..295 225 30 Plus
Dgri\GH14033-PA 276 GH14033-PA 51..219 100..273 201 30.3 Plus
Dgri\GH14030-PA 270 GH14030-PA 21..210 80..263 197 30.2 Plus
Dgri\GH14025-PA 231 GH14025-PA 30..230 96..294 190 28.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
Osi8-PA 274 CG15591-PA 1..274 34..307 1388 100 Plus
Osi12-PA 295 CG1154-PA 50..247 96..302 268 34 Plus
Osi11-PA 302 CG15596-PA 26..288 77..295 228 28.1 Plus
Osi7-PA 288 CG1153-PA 43..285 97..295 220 26.1 Plus
Osi14-PA 268 CG1155-PA 48..250 104..307 215 29.7 Plus
Osi9-PA 233 CG15592-PA 25..201 91..273 211 29.8 Plus
Osi16-PA 278 CG31561-PA 54..233 101..280 201 29.6 Plus
Osi21-PA 282 CG14925-PA 36..254 78..303 194 28.6 Plus
Osi3-PB 288 CG1150-PB 9..253 45..292 158 22.6 Plus
Osi3-PA 288 CG1150-PA 9..253 45..292 158 22.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24396-PA 285 GI24396-PA 1..285 34..307 978 73.4 Plus
Dmoj\GI23173-PA 316 GI23173-PA 22..293 74..295 247 30.7 Plus
Dmoj\GI24403-PA 272 GI24403-PA 49..250 104..307 210 30.3 Plus
Dmoj\GI24400-PA 289 GI24400-PA 48..218 94..261 203 33.1 Plus
Dmoj\GI24405-PA 277 GI24405-PA 7..219 35..273 202 27 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24060-PA 291 GL24060-PA 1..291 34..307 980 75.3 Plus
Dper\GL23479-PA 317 GL23479-PA 32..250 77..273 234 32.6 Plus
Dper\GL18575-PA 280 GL18575-PA 1..256 34..302 215 28.5 Plus
Dper\GL24067-PA 269 GL24067-PA 22..208 73..259 202 30.6 Plus
Dper\GL24063-PA 307 GL24063-PA 51..220 94..259 202 34.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13833-PA 287 GA13833-PA 1..287 34..307 1002 75.8 Plus
Dpse\GA13356-PA 280 GA13356-PA 1..256 34..302 215 28.5 Plus
Dpse\GA13838-PA 317 GA13838-PA 32..250 77..273 211 31.8 Plus
Dpse\GA11059-PA 310 GA11059-PA 32..223 74..259 205 32.3 Plus
Dpse\GA11061-PA 269 GA11061-PA 22..208 73..259 202 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10869-PA 274 GM10869-PA 1..274 34..307 1409 98.2 Plus
Dsec\GM10562-PA 302 GM10562-PA 26..288 77..295 237 28.8 Plus
Dsec\GM10872-PA 295 GM10872-PA 48..216 94..259 211 35.1 Plus
Dsec\GM10875-PA 268 GM10875-PA 48..207 104..259 196 32.7 Plus
Dsec\GM10879-PA 278 GM10879-PA 62..233 108..280 185 29.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19849-PA 225 GD19849-PA 3..225 66..307 891 84.7 Plus
Dsim\GD19553-PA 302 GD19553-PA 26..288 77..295 234 28.8 Plus
Dsim\GD19852-PA 295 GD19852-PA 48..216 94..259 211 35.1 Plus
Dsim\GD19857-PA 268 GD19857-PA 48..207 104..259 197 31.7 Plus
Dsim\GD19859-PA 278 GD19859-PA 54..233 101..280 190 29.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14253-PA 163 GJ14253-PA 1..159 34..190 467 57.3 Plus
Dvir\GJ14254-PA 92 GJ14254-PA 1..92 215..307 334 93.5 Plus
Dvir\GJ14489-PA 321 GJ14489-PA 29..295 76..295 253 30.5 Plus
Dvir\GJ14264-PA 278 GJ14264-PA 7..222 35..273 212 28.7 Plus
Dvir\GJ14261-PA 277 GJ14261-PA 48..223 104..270 211 31.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13038-PA 256 GK13038-PA 1..256 34..307 876 72 Plus
Dwil\GK21164-PA 231 GK21164-PA 1..228 34..251 857 74.1 Plus
Dwil\GK18622-PA 388 GK18622-PA 1..176 34..199 603 68.2 Plus
Dwil\GK20305-PA 137 GK20305-PA 1..137 174..307 448 77.5 Plus
Dwil\GK20226-PA 97 GK20226-PA 1..92 174..261 363 82.6 Plus
Dwil\GK18622-PA 388 GK18622-PA 175..333 127..288 161 28.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10191-PA 274 GE10191-PA 1..274 34..307 1249 94.5 Plus
Dyak\GE24110-PA 302 GE24110-PA 37..297 91..304 229 28.6 Plus
Dyak\GE10195-PA 298 GE10195-PA 50..218 94..259 207 34.5 Plus
Dyak\GE10198-PA 268 GE10198-PA 48..207 104..259 197 31.7 Plus
Dyak\GE10192-PA 233 GE10192-PA 30..232 96..294 172 29.4 Plus