Clone MIP24513 Report

Search the DGRC for MIP24513

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:245
Well:13
Vector:pOT2
Protein status:MIP24513.pep: Imported from assembly
Sequenced Size:599

Clone Sequence Records

MIP24513.complete Sequence

599 bp assembled on 2010-08-11

GenBank Submission: BT125098.1

> MIP24513.complete
CTTCACAAGCTGACTTGGGTTCTAATATTTATACCTGCTTTTCGAGCTGC
CGATCCCATTTGCTCTCAAAGGCCGGATGTAACTGCCTTGAGAAACTGTT
GCAAGCTGCCTAATCTGGACTTTTCGAGTTTCAACTCCAAGTGCAGTCAG
TATTTGGTCAATGGAGTCCACATATCACCTTGCAGCTTTGAGTGCATCTT
TCGAGCGGCGAATGCATTAAATGGCACCCATTTGGTTATGGAAAATATCG
AAAAGATGATGAAAACCATTTTGGGCTCTGATGAATTTGTGCACGTGTAT
CTGGATGGATTCAGGAGCTGCGGTAATCAGGAGAAGGTGCTCATTAAGGC
AATGAAACGTCGCCGTGTTCCCATCACCGGAAAATGTGGCTCGATGGCGA
TAATGTATGGCCTGTGTGCCCATCGATATGTCTACCGTAATTGCCCGGAA
AGCGTGTGGAGCAAGAGTGCCACCTGCAATGAGGCCAGGGAATACAGCAT
TCGCTGCGATGACATGTAATAGATGGGACTATTAAACTTAAATAAATCAC
ACATAGTCAGCTGCTTTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP24513.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10260725..10261112 181..568 1940 100 Plus
chr2R 21145070 chr2R 10260570..10260665 85..180 480 100 Plus
chr2R 21145070 chr2R 10260431..10260515 1..85 425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14373421..14373809 181..569 1945 100 Plus
2R 25286936 2R 14373266..14373361 85..180 480 100 Plus
2R 25286936 2R 14373127..14373211 1..85 425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14374620..14375008 181..569 1945 100 Plus
2R 25260384 2R 14374465..14374560 85..180 480 100 Plus
2R 25260384 2R 14374326..14374410 1..85 425 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:16:20 has no hits.

MIP24513.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:16:56 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10260431..10260514 1..84 100 -> Plus
chr2R 10260570..10260665 85..180 100 -> Plus
chr2R 10260725..10261112 181..568 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-11 16:48:37 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50d-RA 4..522 1..519 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:50:22 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50d-RA 4..522 1..519 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:25 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50d-RA 4..522 1..519 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:56:39 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50d-RA 4..522 1..519 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-11 16:48:37 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50d-RA 4..522 1..519 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:50:21 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50d-RA 4..522 1..519 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:25 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50d-RA 20..587 1..568 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:56:39 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
Obp50d-RA 20..587 1..568 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:56 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14373127..14373210 1..84 100 -> Plus
2R 14373266..14373361 85..180 100 -> Plus
2R 14373421..14373808 181..568 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:56 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14373127..14373210 1..84 100 -> Plus
2R 14373266..14373361 85..180 100 -> Plus
2R 14373421..14373808 181..568 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:16:56 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14373127..14373210 1..84 100 -> Plus
2R 14373266..14373361 85..180 100 -> Plus
2R 14373421..14373808 181..568 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:25 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10260632..10260715 1..84 100 -> Plus
arm_2R 10260771..10260866 85..180 100 -> Plus
arm_2R 10260926..10261313 181..568 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:26:14 Download gff for MIP24513.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14374620..14375007 181..568 100   Plus
2R 14374326..14374409 1..84 100 -> Plus
2R 14374465..14374560 85..180 100 -> Plus

MIP24513.pep Sequence

Translation from 0 to 518

> MIP24513.pep
LHKLTWVLIFIPAFRAADPICSQRPDVTALRNCCKLPNLDFSSFNSKCSQ
YLVNGVHISPCSFECIFRAANALNGTHLVMENIEKMMKTILGSDEFVHVY
LDGFRSCGNQEKVLIKAMKRRRVPITGKCGSMAIMYGLCAHRYVYRNCPE
SVWSKSATCNEAREYSIRCDDM*

MIP24513.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13502-PA 177 GF13502-PA 12..173 10..171 632 64.8 Plus
Dana\GF13501-PA 193 GF13501-PA 27..181 18..171 278 32.7 Plus
Dana\GF11354-PA 180 GF11354-PA 36..168 33..169 161 29 Plus
Dana\GF11352-PA 196 GF11352-PA 24..188 21..172 137 24.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20451-PA 174 GG20451-PA 2..173 1..172 790 82.6 Plus
Dere\GG20450-PA 186 GG20450-PA 3..174 2..169 262 29.1 Plus
Dere\GG22428-PA 181 GG22428-PA 13..169 8..169 172 28.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19745-PA 166 GH19745-PA 44..153 61..170 194 34.2 Plus
Dgri\GH22122-PA 175 GH22122-PA 2..163 4..169 156 26 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
Obp50d-PA 173 CG30074-PA 2..173 1..172 933 100 Plus
Obp50c-PC 185 CG30072-PC 14..174 13..169 284 32.3 Plus
Obp50a-PA 181 CG30067-PA 10..169 4..169 169 24.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20279-PA 154 GI20279-PA 4..141 33..169 204 32.4 Plus
Dmoj\GI19255-PA 179 GI19255-PA 4..167 2..169 195 29.1 Plus
Dmoj\GI19915-PA 208 GI19915-PA 22..196 17..169 151 24.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10690-PA 187 GL10690-PA 17..187 2..170 604 63.7 Plus
Dper\GL10689-PA 424 GL10689-PA 240..413 1..172 303 32.8 Plus
Dper\GL11401-PA 198 GL11401-PA 9..190 6..172 142 24.9 Plus
Dper\GL11403-PA 171 GL11403-PA 20..159 26..169 139 25.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp50d-PA 187 GA15625-PA 17..187 2..170 603 63.2 Plus
Dpse\Obp50c-PA 99 GA15623-PA 1..88 86..172 157 31.8 Plus
Dpse\Obp50e-PA 198 GA12642-PA 9..190 6..172 142 24.9 Plus
Dpse\Obp50a-PA 171 GA15619-PA 20..159 26..169 138 25.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21538-PA 173 GM21538-PA 2..173 1..172 844 89.5 Plus
Dsec\GM21537-PA 185 GM21537-PA 8..174 4..169 287 32.9 Plus
Dsec\GM20215-PA 180 GM20215-PA 5..168 3..169 163 27.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp50d-PA 173 GD11048-PA 2..173 1..172 862 91.3 Plus
Dsim\Obp50c-PA 185 GD11047-PA 14..174 13..169 285 33.5 Plus
Dsim\Obp50a-PA 155 GD25686-PA 7..154 1..155 156 26.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp50c-PA 188 GJ22008-PA 9..175 4..170 282 34.3 Plus
Dvir\Obp50a-PA 179 GJ20334-PA 2..167 3..169 172 25.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21475-PA 167 GK21475-PA 2..157 16..170 510 54.5 Plus
Dwil\GK19396-PA 179 GK19396-PA 24..171 21..170 423 47 Plus
Dwil\GK21472-PA 195 GK21472-PA 9..180 4..169 321 34.9 Plus
Dwil\GK21837-PA 182 GK21837-PA 5..171 7..170 157 25.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13583-PA 173 GE13583-PA 2..173 1..172 802 84.3 Plus
Dyak\GE13581-PA 188 GE13581-PA 24..176 18..169 283 34 Plus
Dyak\GE12317-PA 181 GE12317-PA 12..169 7..169 176 28.6 Plus

MIP24513.hyp Sequence

Translation from 0 to 518

> MIP24513.hyp
LHKLTWVLIFIPAFRAADPICSQRPDVTALRNCCKLPNLDFSSFNSKCSQ
YLVNGVHISPCSFECIFRAANALNGTHLVMENIEKMMKTILGSDEFVHVY
LDGFRSCGNQEKVLIKAMKRRRVPITGKCGSMAIMYGLCAHRYVYRNCPE
SVWSKSATCNEAREYSIRCDDM*

MIP24513.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Obp50d-PA 173 CG30074-PA 2..173 1..172 933 100 Plus
Obp50c-PC 185 CG30072-PC 14..174 13..169 284 32.3 Plus
Obp50a-PA 181 CG30067-PA 10..169 4..169 169 24.6 Plus