Clone MIP24521 Report

Search the DGRC for MIP24521

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:245
Well:21
Vector:pOT2
Associated Gene/TranscriptCG13046-RB
Protein status:MIP24521.pep: gold
Sequenced Size:800

Clone Sequence Records

MIP24521.complete Sequence

800 bp assembled on 2010-08-11

GenBank Submission: BT125095.1

> MIP24521.complete
CTGCGCCAGCGCACATCAACGATTATAAGATTCGGCAAAAATATTGGCCT
TTAAACTGCATTTACCCCAAGAACTGGAACCCAAAGAAAAGTGAAGTGAA
ATGGCGCCCAATTTGACTTGTGTATGGATTACTCTGCTGCAACTCATGAG
CTTGGCTCTGGCCGATGTCTCACACCTGGATTACTCGATAGCACCCAGCA
CCCAGCTGGGTTACTATCACTATCCCGCTCCCAACAGGCCAGCCGTGCAG
CGGAGCCAGAGGAACCAGTACCAACAGAACCAGCAGTATCCCCAAGTGGC
ACGACAGTTTGCCGAGCCCGCCTTGGAGCATGCCGCCTTCACCCAGGCTC
TGACCAGCCAGGGTTACGTATTTGGAGCACCGTCGTCTGCCCTCCAGGTG
GCTCCCCCGGCACCACAGCCCCAGCAGGTGGCCAGAGTATCATCTGCTGC
GGGATCGGCCACAGGTCGTTCCATATCCTCCGCTTCCGTGGATGCCAACT
CGCTGAATCTCAAGCTGCCAGTGCCCTTTGGCATTGCTCCACTGAATGTG
GCGCAACTTCCGCTGCAGGCTGGGGCACCATATGCCAGTGTGCCCAGAAC
CACGGGGCTAACCTCCTATGGAACACCGCAGATCCAGAGGCGCTAGTCCA
GCAATCCTAGCCCATAGAATAGCAATAGCAATACATTTAATAGAGCCAGA
GCCATCCCGACTGATCATCAAACTGCGATGACTTCTGCTCTTAGTGAATA
CACATTGATAATAAACTTGCCATCTAAGCTTAAAAAAAAAAAAAAAAAAA

MIP24521.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16277308..16277976 781..113 3210 98.7 Minus
chr3L 24539361 chr3L 16278035..16278150 116..1 565 99.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16287579..16288248 782..113 3350 100 Minus
3L 28110227 3L 16288307..16288422 116..1 565 99.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16280679..16281348 782..113 3350 100 Minus
3L 28103327 3L 16281407..16281522 116..1 565 99.1 Minus
Blast to na_te.dros performed on 2019-03-16 07:18:20 has no hits.

MIP24521.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:18:59 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16277308..16277976 113..781 98 <- Minus
chr3L 16278039..16278150 1..112 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-11 16:13:23 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
CG13046-RB 1..546 101..646 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:50:18 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
CG13046-RB 1..546 101..646 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:22:36 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
CG13046-RB 1..546 101..646 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:31:07 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
CG13046-RB 1..546 101..646 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-11 16:13:22 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
CG13046-RB 1..546 101..646 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:50:18 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
CG13046-RB 1..546 101..646 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:22:36 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
CG13046-RB 1..781 1..781 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:31:07 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
CG13046-RB 1..781 1..781 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:59 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16287580..16288248 113..781 100 <- Minus
3L 16288311..16288422 1..112 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:59 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16287580..16288248 113..781 100 <- Minus
3L 16288311..16288422 1..112 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:59 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16287580..16288248 113..781 100 <- Minus
3L 16288311..16288422 1..112 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:22:36 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16280680..16281348 113..781 100 <- Minus
arm_3L 16281411..16281522 1..112 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:26:10 Download gff for MIP24521.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16280680..16281348 113..781 100 <- Minus
3L 16281411..16281522 1..112 100   Minus

MIP24521.pep Sequence

Translation from 100 to 645

> MIP24521.pep
MAPNLTCVWITLLQLMSLALADVSHLDYSIAPSTQLGYYHYPAPNRPAVQ
RSQRNQYQQNQQYPQVARQFAEPALEHAAFTQALTSQGYVFGAPSSALQV
APPAPQPQQVARVSSAAGSATGRSISSASVDANSLNLKLPVPFGIAPLNV
AQLPLQAGAPYASVPRTTGLTSYGTPQIQRR*

MIP24521.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10302-PA 224 GF10302-PA 1..33 17..49 147 81.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13474-PA 181 GG13474-PA 1..181 1..181 671 90.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15613-PA 178 GH15613-PA 23..178 16..181 433 57.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13046-PB 181 CG13046-PB 1..181 1..181 923 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12661-PA 168 GI12661-PA 8..168 10..181 431 57.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18015-PA 200 GL18015-PA 1..200 1..181 444 62.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12000-PA 202 GA12000-PA 1..202 1..181 439 61.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24423-PA 181 GM24423-PA 1..181 1..181 913 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12494-PA 161 GD12494-PA 1..161 1..181 789 88.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12638-PA 169 GJ12638-PA 21..169 17..181 453 62.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17646-PA 182 GK17646-PA 8..182 22..181 420 58.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23107-PA 181 GE23107-PA 1..181 1..181 812 93.9 Plus

MIP24521.hyp Sequence

Translation from 100 to 645

> MIP24521.hyp
MAPNLTCVWITLLQLMSLALADVSHLDYSIAPSTQLGYYHYPAPNRPAVQ
RSQRNQYQQNQQYPQVARQFAEPALEHAAFTQALTSQGYVFGAPSSALQV
APPAPQPQQVARVSSAAGSATGRSISSASVDANSLNLKLPVPFGIAPLNV
AQLPLQAGAPYASVPRTTGLTSYGTPQIQRR*

MIP24521.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13046-PB 181 CG13046-PB 1..181 1..181 923 100 Plus