Clone MIP24650 Report

Search the DGRC for MIP24650

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:246
Well:50
Vector:pOT2
Associated Gene/TranscriptCG18607-RA
Protein status:MIP24650.pep: gold
Sequenced Size:762

Clone Sequence Records

MIP24650.complete Sequence

762 bp assembled on 2010-08-11

GenBank Submission: BT125109.1

> MIP24650.complete
ATTAGCTCCGGATCGCGATGACTCCCACGACAATAGATGGCGTCACGATA
CGCATCATGCGCCCAGAGGATTATGCACAGGTAAAAGCCTATATGGAGGC
TGAGTACTACACATCGGAGCCTCTGTGCCAGTCCAGCGGCGAACCCGTTC
ACCAGCAGAACGAGGAGATCAACGACGCCTTCAACCAGTCGATAATCGCC
GAGGGCACCAGCCTTTTGGCACTGGATGAAAACGATGGTGGCCGGATTGT
GGGTCTAGTTCTGGCATGTGCCAGTTATCCCGATAATGTGAATGCAGGAA
CATTGAATTTGAAGCTCGAGAATGTGGAGGATAACGCTTGGGGTCGAATG
TATCATTTACTAATGAAGGCCAAGCGCGAAGTCAATCTGTTTGAGCGCTA
CGACATCCCGAAGGCGCTCTACTCCCACGTGACCAGCGTGGCCTCGTGGA
AGAGGGGCAAGGGCCTGGGCTCCCGCCTGGCCGCCACCCTGATGGAGCTG
GGCCGATCGAATGGTTTCCCCCTTATGATGGCCTTCTGCACTAGCTTCTA
CTCCGCTCGCCAGAAGGGGGCCTTGGGCATGGAGTGCATCTATTCCATCG
ACTACGCCGACTATAAGGACGATGAAGGACGAGTGATCTTCACACCGGCA
GCCCCACACACAAAGCTGCGAGTGATGGCAATCAAACTGTGACAGTTGAT
AACAAATAACTGAGTCGAGGAATTTAAATAAATTATATAACTATAAAAAA
AAAAAAAAAAAA

MIP24650.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15176278..15177020 1..744 3670 99.9 Plus
chr2L 23010047 chr2L 20023481..20023790 692..383 515 77.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19289109..19289853 1..745 3725 100 Plus
2L 23513712 2L 20025113..20025422 692..383 515 77.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19290308..19291052 1..745 3725 100 Plus
2L 23513712 2L 20025144..20025422 661..383 510 78.8 Minus
Blast to na_te.dros performed on 2019-03-17 00:12:59 has no hits.

MIP24650.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:13:36 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15176278..15176996 1..720 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-11 17:23:45 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
CG18607-RA 1..675 18..692 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:50:35 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
CG18607-RA 1..675 18..692 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:32:10 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
CG18607-RA 1..675 18..692 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:14:31 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
CG18607-RA 1..675 18..692 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-11 17:23:45 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
CG18607-RA 1..675 18..692 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:50:35 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
CG18607-RA 1..675 18..692 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:32:10 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
CG18607-RA 1..744 1..744 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:14:31 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
CG18607-RA 1..744 1..744 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:36 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19289109..19289852 1..744 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:36 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19289109..19289852 1..744 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:36 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19289109..19289852 1..744 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:32:10 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15176614..15177357 1..744 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:26:30 Download gff for MIP24650.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19290308..19291051 1..744 100   Plus

MIP24650.hyp Sequence

Translation from 17 to 691

> MIP24650.hyp
MTPTTIDGVTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEE
INDAFNQSIIAEGTSLLALDENDGGRIVGLVLACASYPDNVNAGTLNLKL
ENVEDNAWGRMYHLLMKAKREVNLFERYDIPKALYSHVTSVASWKRGKGL
GSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIYSIDYADYK
DDEGRVIFTPAAPHTKLRVMAIKL*

MIP24650.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG18607-PA 224 CG18607-PA 1..224 1..224 1166 100 Plus
CG10659-PA 222 CG10659-PA 1..222 1..224 673 57.6 Plus
CG10476-PA 222 CG10476-PA 7..222 7..224 415 39.9 Plus
CG18606-PB 222 CG18606-PB 7..222 7..224 408 39.4 Plus
AANATL2-PB 216 CG9486-PB 1..216 6..224 312 33.2 Plus

MIP24650.pep Sequence

Translation from 17 to 691

> MIP24650.pep
MTPTTIDGVTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEE
INDAFNQSIIAEGTSLLALDENDGGRIVGLVLACASYPDNVNAGTLNLKL
ENVEDNAWGRMYHLLMKAKREVNLFERYDIPKALYSHVTSVASWKRGKGL
GSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIYSIDYADYK
DDEGRVIFTPAAPHTKLRVMAIKL*

MIP24650.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24634-PA 222 GF24634-PA 1..222 1..224 730 59.8 Plus
Dana\GF20033-PA 209 GF20033-PA 5..209 18..224 511 45.4 Plus
Dana\GF23038-PA 182 GF23038-PA 2..182 1..224 361 36.6 Plus
Dana\GF14512-PA 219 GF14512-PA 4..219 9..224 358 35 Plus
Dana\GF10714-PA 205 GF10714-PA 1..202 1..205 344 36.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21595-PA 222 GG21595-PA 1..222 1..224 750 61.2 Plus
Dere\GG21596-PA 222 GG21596-PA 1..222 1..224 743 61.2 Plus
Dere\GG10399-PA 216 GG10399-PA 1..216 6..224 339 34.1 Plus
Dere\GG18468-PA 218 GG18468-PA 11..218 9..224 238 28.7 Plus
Dere\GG22946-PA 275 GG22946-PA 58..262 10..221 207 30.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10999-PA 223 GH10999-PA 9..223 7..224 632 57.3 Plus
Dgri\GH11000-PA 211 GH11000-PA 1..211 14..224 355 36.1 Plus
Dgri\GH11001-PA 214 GH11001-PA 5..214 11..224 350 35.3 Plus
Dgri\GH12774-PA 217 GH12774-PA 4..217 3..224 298 32 Plus
Dgri\GH11973-PA 226 GH11973-PA 4..218 12..224 183 23.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
AANATL4-PA 224 CG18607-PA 1..224 1..224 1166 100 Plus
AANATL3-PA 222 CG10659-PA 1..222 1..224 673 57.6 Plus
AANATL5-PA 222 CG10476-PA 7..222 7..224 415 39.9 Plus
AANATL6-PB 222 CG18606-PB 7..222 7..224 408 39.4 Plus
AANATL2-PB 216 CG9486-PB 1..216 6..224 312 33.2 Plus
AANATL2-PA 216 CG9486-PA 1..216 6..224 312 33.2 Plus
AgmNAT-PA 216 CG15766-PA 1..216 1..224 247 29 Plus
AANATL7-PD 228 CG13759-PD 4..210 12..218 207 28.7 Plus
AANATL7-PC 228 CG13759-PC 4..210 12..218 207 28.7 Plus
AANATL7-PB 228 CG13759-PB 4..210 12..218 207 28.7 Plus
AANATL7-PA 228 CG13759-PA 4..210 12..218 207 28.7 Plus
AANAT1-PA 240 CG3318-PA 23..227 10..221 186 28.7 Plus
AANAT1-PB 275 CG3318-PB 58..262 10..221 186 28.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17517-PA 224 GI17517-PA 9..224 7..224 647 56.9 Plus
Dmoj\GI11371-PA 222 GI11371-PA 9..222 7..224 547 48.2 Plus
Dmoj\GI17524-PA 222 GI17524-PA 9..222 7..224 532 47 Plus
Dmoj\GI17564-PA 174 GI17564-PA 6..170 49..220 437 44.8 Plus
Dmoj\GI17520-PA 213 GI17520-PA 2..213 9..224 389 38.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11101-PA 224 GL11101-PA 7..224 5..224 702 59.1 Plus
Dper\GL26282-PA 225 GL26282-PA 1..225 1..224 526 46.7 Plus
Dper\GL26277-PA 196 GL26277-PA 1..182 1..187 502 52.9 Plus
Dper\GL25512-PA 221 GL25512-PA 6..221 9..224 404 39.5 Plus
Dper\GL15167-PA 215 GL15167-PA 7..215 9..224 291 32.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24612-PA 224 GA24612-PA 7..224 5..224 701 59.1 Plus
Dpse\GA28106-PA 219 GA28106-PA 1..219 1..224 659 56.2 Plus
Dpse\GA28109-PA 225 GA28109-PA 1..225 1..224 528 47.1 Plus
Dpse\GA21823-PA 221 GA21823-PA 6..221 9..224 399 39 Plus
Dpse\GA13941-PA 215 GA13941-PA 7..215 9..224 291 32.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21944-PA 224 GM21944-PA 1..224 1..224 1114 92.4 Plus
Dsec\GM19842-PA 211 GM19842-PA 7..211 7..224 393 39.1 Plus
Dsec\GM18616-PA 216 GM18616-PA 1..216 6..224 325 32.3 Plus
Dsec\GM13165-PA 137 GM13165-PA 2..137 89..224 257 40.6 Plus
Dsec\GM12613-PA 216 GM12613-PA 7..216 7..224 243 28.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11441-PA 224 GD11441-PA 1..224 1..224 1159 95.5 Plus
Dsim\GD21720-PA 222 GD21720-PA 1..222 1..224 714 58.9 Plus
Dsim\GD11440-PA 222 GD11440-PA 7..222 7..224 422 39.4 Plus
Dsim\GD25332-PA 222 GD25332-PA 1..222 1..224 413 39.3 Plus
Dsim\GD23397-PA 216 GD23397-PA 1..216 6..224 322 31.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18418-PA 224 GJ18418-PA 2..224 3..224 667 57.8 Plus
Dvir\GJ15312-PA 224 GJ15312-PA 2..224 3..224 667 57.8 Plus
Dvir\GJ15301-PA 221 GJ15301-PA 9..221 7..224 590 54.6 Plus
Dvir\GJ15334-PA 232 GJ15334-PA 5..217 11..224 400 38.5 Plus
Dvir\GJ15323-PA 217 GJ15323-PA 5..217 11..224 371 37.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15376-PA 223 GK15376-PA 1..223 1..224 656 55.6 Plus
Dwil\GK15375-PA 223 GK15375-PA 1..223 1..224 654 55.6 Plus
Dwil\GK15377-PA 223 GK15377-PA 1..223 1..224 629 53.3 Plus
Dwil\GK15374-PA 209 GK15374-PA 1..209 14..224 622 56.9 Plus
Dwil\GK10929-PA 208 GK10929-PA 1..208 14..224 511 46.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12035-PA 219 GE12035-PA 1..219 6..224 928 79 Plus
Dyak\GE12614-PA 222 GE12614-PA 1..222 1..224 745 60.7 Plus
Dyak\GE12032-PA 222 GE12032-PA 1..222 1..224 383 37.1 Plus
Dyak\GE13747-PA 216 GE13747-PA 1..216 6..224 337 33.5 Plus
Dyak\GE16784-PA 235 GE16784-PA 7..235 7..224 216 26.8 Plus