Clone MIP25832 Report

Search the DGRC for MIP25832

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:258
Well:32
Vector:pOT2
Associated Gene/TranscriptCG42497-RA
Protein status:MIP25832.pep2: Inserted from web MIP25832.pep: gold
Sequenced Size:725

Clone Sequence Records

MIP25832.complete Sequence

725 bp assembled on 2011-03-04

GenBank Submission: BT126130.1

> MIP25832.complete
CGCACACCTTCCAACGGAACGCGTTAGTGTGTCGTTTTTTCGTAGCAGGC
TATGTCGTTGGGCAACGCAGGGCGAATCGCTGTCTGTTGGACTGTTTTGA
CCGTGGGTGGCGTCTACGCATTTGTGCTGTCAAAGAGATCCGTTGAGAAC
CGGCGTTACGAGAGCATGCGAGTGCGTGAGCGCATGAGGAAGGCAAACCA
AGGGGATTACGACTCAAGCGCAGCATCGGACAGGCGATTCGATTACTAAG
CGGCAGCATCCAGTACCTAAAACCCATCAGTAACACACCCACACCCACAC
AATGGCATTGCCCCAGATCAGCACCGCAGACCAGGCCAAGCTGCAGCTGA
TGCAGGAAATGGAGATCGAAATGATGTCCGATTTATATAACCGCATGACG
AACGCTTGCCACAAAAAGTGCATTCCGCCGCGCTACTCCGAGTCGGAGTT
GGGCAAAGGCGAGATGGTGTGCATCGATCGCTGTGTGGCCAAATATCTGG
ACATTCACGAGAAGATCGGCAAGAAGCTGACGGCCATGTCCATGCAGGAC
GAGGAGCTGATGAAGAAGATGTCTAGTTAACCTGGCACCCATTAACCCAC
ATTTCCGCTTAACCAATGTGCATTTTTGAAGCGCTACGATTGTTAGAGGT
ACATGTACAAAACACCCCGTTGTAGAGAATAAACCACAGATTTATGTGTG
CTACATAAAAAAAAAAAAAAAAAAA

MIP25832.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17577122..17577486 453..89 1825 100 Minus
chr2R 21145070 chr2R 17576706..17576960 706..452 1260 99.6 Minus
chr2R 21145070 chr2R 17577556..17577645 90..1 420 97.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21690637..21691001 453..89 1825 100 Minus
2R 25286936 2R 21690219..21690475 708..452 1285 100 Minus
2R 25286936 2R 21691071..21691160 90..1 450 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21691836..21692200 453..89 1825 100 Minus
2R 25260384 2R 21691418..21691674 708..452 1285 100 Minus
2R 25260384 2R 21692270..21692359 90..1 450 100 Minus
Blast to na_te.dros performed 2019-03-16 22:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 6386..6442 384..329 138 73.7 Minus

MIP25832.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:50 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17577557..17577645 1..89 97   Minus
chr2R 17576706..17576959 453..706 99 <- Minus
chr2R 17577123..17577485 90..452 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-09 09:22:33 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RA 1..279 302..580 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:28 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RB 1..279 302..580 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:54 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RB 1..279 302..580 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:22:33 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RA 1..684 23..706 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:28 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 1..685 22..706 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:54 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 1..685 22..706 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:50 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21690221..21690474 453..706 100 <- Minus
2R 21690638..21691000 90..452 100 <- Minus
2R 21691072..21691160 1..89 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:50 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21690221..21690474 453..706 100 <- Minus
2R 21690638..21691000 90..452 100 <- Minus
2R 21691072..21691160 1..89 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:50 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21690221..21690474 453..706 100 <- Minus
2R 21690638..21691000 90..452 100 <- Minus
2R 21691072..21691160 1..89 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:28 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17577726..17577979 453..706 100 <- Minus
arm_2R 17578143..17578505 90..452 100 <- Minus
arm_2R 17578577..17578665 1..89 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:34 Download gff for MIP25832.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21691420..21691673 453..706 100 <- Minus
2R 21691837..21692199 90..452 100 <- Minus
2R 21692271..21692359 1..89 100   Minus

MIP25832.pep Sequence

Translation from 51 to 248

> MIP25832.pep
MSLGNAGRIAVCWTVLTVGGVYAFVLSKRSVENRRYESMRVRERMRKANQ
GDYDSSAASDRRFDY*

MIP25832.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:59:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11624-PA 64 GF11624-PA 1..64 1..65 291 84.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG42497-PA 65 CG42497-PA 1..65 1..65 333 100 Plus

MIP25832.pep2 Sequence

Translation from 301 to 579

> MIP25832.pep2
MALPQISTADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESEL
GKGEMVCIDRCVAKYLDIHEKIGKKLTAMSMQDEELMKKMSS*

MIP25832.pep2 Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2020-09-21 11:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11625-PA 92 GF11625-PA 1..92 1..92 474 98.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2020-09-21 11:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20751-PA 92 GG20751-PA 1..92 1..92 472 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2020-09-21 11:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22682-PA 92 GH22682-PA 1..92 1..92 457 94.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2020-09-21 11:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-PA 92 CG9878-PA 1..92 1..92 475 100 Plus
Tim10-PB 92 CG9878-PB 1..92 1..92 475 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2020-09-21 11:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20610-PA 93 GI20610-PA 3..93 2..92 459 95.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2020-09-21 11:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11269-PA 92 GL11269-PA 1..92 1..92 425 88 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2020-09-21 11:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22092-PA 92 GA22092-PA 1..92 1..92 425 88 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2020-09-21 11:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15694-PA 92 GM15694-PA 1..92 1..92 478 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2020-09-21 11:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25173-PA 92 GD25173-PA 1..92 1..92 478 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2020-09-21 11:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21050-PA 92 GJ21050-PA 1..92 1..92 462 95.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2020-09-21 11:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10647-PA 92 GK10647-PA 1..92 1..92 467 96.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2020-09-21 11:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13683-PA 92 GE13683-PA 1..92 1..92 472 97.8 Plus

MIP25832.hyp Sequence

Translation from 301 to 579

> MIP25832.hyp
MALPQISTADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESEL
GKGEMVCIDRCVAKYLDIHEKIGKKLTAMSMQDEELMKKMSS*

MIP25832.hyp Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2020-09-21 11:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-PA 92 CG9878-PA 1..92 1..92 475 100 Plus
Tim10-PB 92 CG9878-PB 1..92 1..92 475 100 Plus