Clone MIP26102 Report

Search the DGRC for MIP26102

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:261
Well:2
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG18540-RB
Protein status:MIP26102.pep: gold
Sequenced Size:655

Clone Sequence Records

MIP26102.complete Sequence

655 bp assembled on 2010-08-20

GenBank Submission: BT125585.1

> MIP26102.complete
GTCAATTTAACCAGAAATGATTTCGTTTTGCATTTCATCGCTTTTATCAG
TGTGTATTTTTGCAAACCTTTACAATGGTTGTGCGGCAAAGCCCAACTGG
GAGGCAACGCCATTGTCGATTGGTGGCACCACCACAAATCCCAGTGCCAT
GGACATGAATCTGCGAATTGAGCGCATTTCAAGGTCGGAATTCGGGTTTT
CAGGCACATTCTTCTGGAATATTGATGTGGACGATAGCGTGATGGTCGAG
ATGCGTATTCTGAGCAGTTACTCCGGTGACGAGTCCGATTACAAACTGAC
TCCCATGTCCATTCAACCGCAGAAATTCACCGAATATGTCAATACCTTTT
ACAAGGACCTGTTGTTGCCGAATCTGGGCAATTGCACCGATTTGCCCGTC
TATGAAAATGAATTTGTACCACCCTGGCCCAAGGCGACCTACAATTTCAC
CCGCTGCGCTCTGAACGGCCAAGGATTGCCGGATATTTTGGCAGATGGCT
TCTATAAAGGCGAAGCCGTCATCACCGCCCAGCCAAATCTTGAAGTCACC
GTGTCCGTCGTTCTGCGGATCAGAACGAAAATGTTCTAAATATTCGAGCA
TTAAATCGCAGAACATCTTCTCACTCTAAAAAAAAAAAAAAAAAAAAAAA
AAAAA

MIP26102.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14186756..14187136 244..624 1875 99.5 Plus
chr2R 21145070 chr2R 14186541..14186697 90..246 785 100 Plus
chr2R 21145070 chr2R 14186384..14186474 1..91 440 98.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18299689..18300073 244..628 1925 100 Plus
2R 25286936 2R 18299474..18299630 90..246 785 100 Plus
2R 25286936 2R 18299317..18299407 1..91 455 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18300888..18301272 244..628 1925 100 Plus
2R 25260384 2R 18300673..18300829 90..246 785 100 Plus
2R 25260384 2R 18300516..18300606 1..91 455 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:26:13 has no hits.

MIP26102.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:27:07 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14186384..14186474 1..91 98 -> Plus
chr2R 14186543..14186695 92..244 100 -> Plus
chr2R 14186757..14187139 245..627 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-20 16:06:51 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG18540-RA 17..516 90..589 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:39:36 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG18540-RA 17..516 90..589 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:48:16 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG18540-RB 1..573 17..589 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:10:27 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG18540-RB 1..573 17..589 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-20 16:06:51 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG18540-RA 17..516 90..589 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:39:36 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG18540-RA 17..516 90..589 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:48:16 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG18540-RB 1..627 1..627 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:10:27 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
CG18540-RB 1..627 1..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:07 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18299317..18299407 1..91 100 -> Plus
2R 18299476..18299628 92..244 100 -> Plus
2R 18299690..18300072 245..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:07 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18299317..18299407 1..91 100 -> Plus
2R 18299476..18299628 92..244 100 -> Plus
2R 18299690..18300072 245..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:27:07 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18299317..18299407 1..91 100 -> Plus
2R 18299476..18299628 92..244 100 -> Plus
2R 18299690..18300072 245..627 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:48:16 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14186822..14186912 1..91 100 -> Plus
arm_2R 14186981..14187133 92..244 100 -> Plus
arm_2R 14187195..14187577 245..627 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:42:47 Download gff for MIP26102.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18300889..18301271 245..627 100   Plus
2R 18300516..18300606 1..91 100 -> Plus
2R 18300675..18300827 92..244 100 -> Plus

MIP26102.pep Sequence

Translation from 16 to 588

> MIP26102.pep
MISFCISSLLSVCIFANLYNGCAAKPNWEATPLSIGGTTTNPSAMDMNLR
IERISRSEFGFSGTFFWNIDVDDSVMVEMRILSSYSGDESDYKLTPMSIQ
PQKFTEYVNTFYKDLLLPNLGNCTDLPVYENEFVPPWPKATYNFTRCALN
GQGLPDILADGFYKGEAVITAQPNLEVTVSVVLRIRTKMF*

MIP26102.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12152-PA 120 GF12152-PA 1..120 71..190 434 60.8 Plus
Dana\GF12154-PA 192 GF12154-PA 28..192 27..190 382 41.7 Plus
Dana\GF12151-PA 189 GF12151-PA 13..165 12..164 313 34.6 Plus
Dana\GF12153-PA 126 GF12153-PA 2..120 64..186 290 43.1 Plus
Dana\GF21782-PA 212 GF21782-PA 12..123 48..161 194 34.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21871-PA 164 GG21871-PA 1..164 27..190 788 86.6 Plus
Dere\GG21867-PA 191 GG21867-PA 16..191 12..190 386 40.4 Plus
Dere\GG21870-PA 185 GG21870-PA 1..178 1..181 377 40.7 Plus
Dere\GG21868-PA 188 GG21868-PA 20..162 22..164 348 42 Plus
Dere\GG21866-PA 188 GG21866-PA 18..164 18..164 337 38.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21657-PA 185 GH21657-PA 15..179 19..188 291 35.9 Plus
Dgri\GH21658-PA 164 GH21658-PA 3..137 28..164 281 36.5 Plus
Dgri\GH21661-PA 164 GH21661-PA 2..159 27..188 248 31.5 Plus
Dgri\GH22995-PA 99 GH22995-PA 18..99 18..99 155 36.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG18540-PB 190 CG18540-PB 1..190 1..190 1007 100 Plus
CG18539-PB 185 CG18539-PB 1..178 1..181 394 42 Plus
CG18536-PA 191 CG18536-PA 16..165 12..164 376 44.4 Plus
CG14502-PD 188 CG14502-PD 22..187 22..189 337 36.3 Plus
CG14502-PC 188 CG14502-PC 22..187 22..189 337 36.3 Plus
CG14502-PB 188 CG14502-PB 22..187 22..189 337 36.3 Plus
CG14502-PA 188 CG14502-PA 22..187 22..189 337 36.3 Plus
CG18537-PA 188 CG18537-PA 16..188 18..190 336 37.6 Plus
CG18539-PC 126 CG18539-PC 2..119 64..181 299 45.8 Plus
CG18538-PA 182 CG18538-PA 19..155 28..163 276 40 Plus
CG34028-PA 189 CG34028-PA 12..167 9..166 194 28.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23934-PA 163 GI23934-PA 2..163 27..190 329 37.2 Plus
Dmoj\GI20111-PA 164 GI20111-PA 2..162 27..189 324 35.6 Plus
Dmoj\GI20114-PA 183 GI20114-PA 7..156 12..164 297 37.3 Plus
Dmoj\GI12571-PA 181 GI12571-PA 16..180 20..189 272 33.5 Plus
Dmoj\GI20113-PA 167 GI20113-PA 4..139 27..164 269 37 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17761-PA 189 GL17761-PA 2..189 4..190 411 39.9 Plus
Dper\GL17760-PA 186 GL17760-PA 2..186 6..190 410 38.9 Plus
Dper\GL19354-PA 186 GL19354-PA 10..186 14..190 370 38 Plus
Dper\GL17762-PA 191 GL17762-PA 30..190 27..189 358 41.1 Plus
Dper\GL17763-PA 178 GL17763-PA 1..150 1..156 357 50.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14982-PA 186 GA14982-PA 1..186 1..190 505 48.4 Plus
Dpse\GA14977-PA 186 GA14977-PA 2..186 6..190 410 39.5 Plus
Dpse\GA24903-PA 186 GA24903-PA 6..186 10..190 406 39.2 Plus
Dpse\GA25932-PA 186 GA25932-PA 10..186 14..190 377 38.5 Plus
Dpse\GA13036-PA 188 GA13036-PA 1..187 1..189 367 34.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21864-PA 146 GM21864-PA 1..146 45..190 738 91.8 Plus
Dsec\GM21863-PA 173 GM21863-PA 12..166 27..181 371 41.9 Plus
Dsec\GM21860-PA 188 GM21860-PA 18..164 18..164 326 37.4 Plus
Dsec\GM21862-PA 181 GM21862-PA 18..154 27..163 323 41.6 Plus
Dsec\GM21861-PA 268 GM21861-PA 105..252 15..164 292 41.3 Plus
Dsec\GM21861-PA 268 GM21861-PA 16..115 12..114 220 43.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11361-PA 158 GD11361-PA 1..158 33..190 787 91.1 Plus
Dsim\GD11357-PA 191 GD11357-PA 16..191 12..190 380 42.6 Plus
Dsim\GD11356-PA 188 GD11356-PA 18..164 18..164 336 39.5 Plus
Dsim\GD11358-PA 188 GD11358-PA 16..188 18..190 335 37.6 Plus
Dsim\GD11359-PA 313 GD11359-PA 143..286 20..163 322 40.3 Plus
Dsim\GD11359-PA 313 GD11359-PA 18..148 27..157 304 41.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15477-PA 185 GJ15477-PA 22..184 24..189 355 39.8 Plus
Dvir\GJ19880-PA 190 GJ19880-PA 7..185 1..188 344 35.6 Plus
Dvir\GJ22468-PA 190 GJ22468-PA 7..189 6..190 339 33.5 Plus
Dvir\GJ19881-PA 190 GJ19881-PA 19..163 18..164 338 42.9 Plus
Dvir\GJ24081-PA 190 GJ24081-PA 30..190 27..190 333 37.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22976-PA 173 GK22976-PA 2..146 25..169 411 49 Plus
Dwil\GK22974-PA 186 GK22974-PA 26..186 28..190 374 42.3 Plus
Dwil\GK22973-PA 188 GK22973-PA 9..171 9..171 309 35 Plus
Dwil\GK25378-PA 186 GK25378-PA 28..186 28..190 219 31.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:19:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11948-PA 146 GE11948-PA 1..146 45..190 701 86.3 Plus
Dyak\GE11944-PA 191 GE11944-PA 8..191 5..190 392 40.3 Plus
Dyak\GE11945-PA 188 GE11945-PA 6..188 8..190 368 38.3 Plus
Dyak\GE11947-PA 168 GE11947-PA 3..161 23..181 361 39.6 Plus
Dyak\GE11943-PA 188 GE11943-PA 18..164 18..164 349 40.8 Plus

MIP26102.hyp Sequence

Translation from 16 to 588

> MIP26102.hyp
MISFCISSLLSVCIFANLYNGCAAKPNWEATPLSIGGTTTNPSAMDMNLR
IERISRSEFGFSGTFFWNIDVDDSVMVEMRILSSYSGDESDYKLTPMSIQ
PQKFTEYVNTFYKDLLLPNLGNCTDLPVYENEFVPPWPKATYNFTRCALN
GQGLPDILADGFYKGEAVITAQPNLEVTVSVVLRIRTKMF*

MIP26102.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG18540-PB 190 CG18540-PB 1..190 1..190 1007 100 Plus
CG18539-PB 185 CG18539-PB 1..178 1..181 394 42 Plus
CG18536-PA 191 CG18536-PA 16..165 12..164 376 44.4 Plus
CG14502-PD 188 CG14502-PD 22..187 22..189 337 36.3 Plus
CG14502-PC 188 CG14502-PC 22..187 22..189 337 36.3 Plus