Clone MIP26111 Report

Search the DGRC for MIP26111

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:261
Well:11
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG18537-RA
Protein status:MIP26111.pep: gold
Sequenced Size:634

Clone Sequence Records

MIP26111.complete Sequence

634 bp assembled on 2011-03-11

GenBank Submission: BT126131.1

> MIP26111.complete
AGTTTCATATTGGCCAAATGGATTCCGGCTATTCGTCAGTCTTAATATTG
TTGGCAGTTTGGCTAATCAGTAGATGCGGAGCAGCGCGGAAATGGGAGTA
CGAACCTGTATTGATATTAACCACCTCTTCGGACGACAGTCTAATAAAAT
TAGAGTCCAGTATTGTTCGCTTAGGGCGTGGAAAGTTTGGAATATCAGCG
CGGGTGGAGTGGAACTATGACACCACTGAGGAGACAATGGTGGAGGCTGT
TGTATACCGCAGCAATTCGGGTGATGAGTCCGACTACAAGCTGCTCCCTT
GGGCCATTCCTAAGCAAACCTTTTACGACTACCTCAACTCCTACTACAAG
GATGTGATAATGAAGAACTTTGCCCCCTGTTCCAATGTGCCGCAGTTCAA
GGGCAAATTTCAACCGCCTTGGCCGAAACGAACGTATATCGGTGACAAAT
GCGTCTTTGAAGCCGAAGGTTTTCCGGATATCGTGCCACCTGGATTCTAC
AAGATTATTTTCAATTGTACCGGACCTGATCAGCCATCGTGGAGCTTTAT
CGGAATTTTTAAAATAATAAACAAAATGTTTTAGCTATGTAGCAATAAAT
ATATATCAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP26111.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14183350..14183718 239..607 1830 99.7 Plus
chr2R 21145070 chr2R 14183134..14183291 86..243 790 100 Plus
chr2R 21145070 chr2R 14182991..14183076 1..86 430 100 Plus
chr2R 21145070 chr2R 14184511..14184683 281..454 265 78.2 Plus
chr2R 21145070 chr2R 14182338..14182438 258..358 205 80.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18296288..18296664 239..615 1870 99.7 Plus
2R 25286936 2R 18296072..18296229 86..243 790 100 Plus
2R 25286936 2R 18295928..18296013 1..86 430 100 Plus
2R 25286936 2R 18297448..18297621 281..454 315 78.7 Plus
2R 25286936 2R 18295272..18295372 258..358 205 80.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18297487..18297863 239..615 1870 99.7 Plus
2R 25260384 2R 18297271..18297428 86..243 790 100 Plus
2R 25260384 2R 18297127..18297212 1..86 430 100 Plus
2R 25260384 2R 18298647..18298820 281..454 315 78.7 Plus
2R 25260384 2R 18296471..18296571 258..358 205 80.1 Plus
Blast to na_te.dros performed 2019-03-16 22:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6837..6890 606..553 116 72.7 Minus
Stalker2 7672 Stalker2 STALKER2 7672bp 7177..7221 560..606 113 74.5 Plus

MIP26111.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:21:31 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14182991..14183076 1..86 100 -> Plus
chr2R 14183135..14183287 87..239 100 -> Plus
chr2R 14183351..14183718 240..607 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-11 14:47:18 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
CG18537-RA 1..567 18..584 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:55:16 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
CG18537-RA 1..567 18..584 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:27:35 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
CG18537-RA 1..567 18..584 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-11 14:47:16 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
CG18537-RA 1..567 18..584 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:55:16 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
CG18537-RA 1..607 1..607 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:27:35 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
CG18537-RA 1..607 1..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:31 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18295928..18296013 1..86 100 -> Plus
2R 18296073..18296225 87..239 100 -> Plus
2R 18296289..18296656 240..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:31 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18295928..18296013 1..86 100 -> Plus
2R 18296073..18296225 87..239 100 -> Plus
2R 18296289..18296656 240..607 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:21:31 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18295928..18296013 1..86 100 -> Plus
2R 18296073..18296225 87..239 100 -> Plus
2R 18296289..18296656 240..607 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:55:16 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14183433..14183518 1..86 100 -> Plus
arm_2R 14183578..14183730 87..239 100 -> Plus
arm_2R 14183794..14184161 240..607 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:01:14 Download gff for MIP26111.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18297488..18297855 240..607 100   Plus
2R 18297127..18297212 1..86 100 -> Plus
2R 18297272..18297424 87..239 100 -> Plus

MIP26111.pep Sequence

Translation from 2 to 583

> MIP26111.pep
FHIGQMDSGYSSVLILLAVWLISRCGAARKWEYEPVLILTTSSDDSLIKL
ESSIVRLGRGKFGISARVEWNYDTTEETMVEAVVYRSNSGDESDYKLLPW
AIPKQTFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQPPWPKRTYIGDKC
VFEAEGFPDIVPPGFYKIIFNCTGPDQPSWSFIGIFKIINKMF*

MIP26111.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12154-PA 192 GF12154-PA 25..192 27..193 610 64.3 Plus
Dana\GF12151-PA 189 GF12151-PA 13..189 15..193 505 49.2 Plus
Dana\GF12153-PA 126 GF12153-PA 3..125 68..192 380 53.6 Plus
Dana\GF12152-PA 120 GF12152-PA 3..120 76..193 273 41.5 Plus
Dana\GF21782-PA 212 GF21782-PA 15..123 54..164 219 39.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21868-PA 188 GG21868-PA 1..188 6..193 784 77.1 Plus
Dere\GG21867-PA 191 GG21867-PA 19..191 21..193 637 63.6 Plus
Dere\GG21869-PA 181 GG21869-PA 17..181 29..193 615 65.5 Plus
Dere\GG21870-PA 185 GG21870-PA 6..184 12..192 493 48.6 Plus
Dere\GG21866-PA 188 GG21866-PA 13..187 13..192 485 48.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:05:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21658-PA 164 GH21658-PA 1..159 29..191 358 39.3 Plus
Dgri\GH21661-PA 164 GH21661-PA 1..159 29..191 333 38 Plus
Dgri\GH21657-PA 185 GH21657-PA 18..179 25..191 323 41.3 Plus
Dgri\GH22995-PA 99 GH22995-PA 14..99 17..102 160 38.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG18537-PA 188 CG18537-PA 1..188 6..193 1017 100 Plus
CG18536-PA 191 CG18536-PA 9..191 11..193 631 60.7 Plus
CG18538-PA 182 CG18538-PA 17..181 29..192 525 58.3 Plus
CG18539-PB 185 CG18539-PB 6..184 12..192 512 51.4 Plus
CG14502-PD 188 CG14502-PD 13..187 13..192 491 46.7 Plus
CG14502-PC 188 CG14502-PC 13..187 13..192 491 46.7 Plus
CG14502-PB 188 CG14502-PB 13..187 13..192 491 46.7 Plus
CG14502-PA 188 CG14502-PA 13..187 13..192 491 46.7 Plus
CG18539-PC 126 CG18539-PC 3..125 68..192 379 52.8 Plus
CG18540-PB 190 CG18540-PB 18..190 21..193 336 37.6 Plus
CG34028-PA 189 CG34028-PA 31..165 31..167 236 35 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20111-PA 164 GI20111-PA 1..159 29..191 439 49.7 Plus
Dmoj\GI20114-PA 183 GI20114-PA 7..175 16..188 401 44.3 Plus
Dmoj\GI20113-PA 167 GI20113-PA 3..161 29..191 350 40.5 Plus
Dmoj\GI12744-PA 187 GI12744-PA 8..170 9..174 311 36.7 Plus
Dmoj\GI12571-PA 181 GI12571-PA 18..181 25..193 293 36.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17760-PA 186 GL17760-PA 4..186 11..193 617 60.7 Plus
Dper\GL17761-PA 189 GL17761-PA 8..189 12..193 560 54.4 Plus
Dper\GL19354-PA 186 GL19354-PA 10..186 17..193 486 48.6 Plus
Dper\GL17759-PA 214 GL17759-PA 52..214 29..193 476 52.1 Plus
Dper\GL17762-PA 191 GL17762-PA 14..190 14..192 463 48.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14977-PA 186 GA14977-PA 4..186 11..193 618 60.7 Plus
Dpse\GA24903-PA 186 GA24903-PA 5..186 12..193 574 56.6 Plus
Dpse\GA13036-PA 188 GA13036-PA 12..188 15..193 502 50.3 Plus
Dpse\GA25932-PA 186 GA25932-PA 10..186 17..193 493 49.2 Plus
Dpse\GA14980-PA 191 GA14980-PA 14..190 14..192 452 47.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21861-PA 268 GM21861-PA 116..263 29..178 619 80.7 Plus
Dsec\GM21862-PA 181 GM21862-PA 17..181 29..193 589 62.4 Plus
Dsec\GM21860-PA 188 GM21860-PA 13..187 13..192 481 48.3 Plus
Dsec\GM21863-PA 173 GM21863-PA 1..172 19..192 465 48.3 Plus
Dsec\GM21861-PA 268 GM21861-PA 24..115 26..117 366 73.9 Plus
Dsec\GM21864-PA 146 GM21864-PA 1..120 48..167 304 44.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11358-PA 188 GD11358-PA 1..188 6..193 860 85.1 Plus
Dsim\GD11357-PA 191 GD11357-PA 9..191 11..193 645 62.3 Plus
Dsim\GD11359-PA 313 GD11359-PA 149..313 29..193 589 62.4 Plus
Dsim\GD11359-PA 313 GD11359-PA 17..148 29..160 492 65.2 Plus
Dsim\GD11356-PA 188 GD11356-PA 13..187 13..192 483 48.3 Plus
Dsim\GD11361-PA 158 GD11361-PA 3..158 38..193 312 38.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22468-PA 190 GJ22468-PA 9..186 11..192 427 45.1 Plus
Dvir\GJ19882-PA 187 GJ19882-PA 10..181 15..191 414 47.5 Plus
Dvir\GJ19880-PA 190 GJ19880-PA 10..185 10..191 407 42.3 Plus
Dvir\GJ19881-PA 190 GJ19881-PA 10..179 12..183 377 42.4 Plus
Dvir\GJ19884-PA 201 GJ19884-PA 10..193 15..188 375 41.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22974-PA 186 GK22974-PA 24..186 29..193 511 56.4 Plus
Dwil\GK22976-PA 173 GK22976-PA 3..149 29..175 426 46.9 Plus
Dwil\GK22973-PA 188 GK22973-PA 4..188 7..193 420 39.6 Plus
Dwil\GK25378-PA 186 GK25378-PA 18..165 21..170 275 37.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11945-PA 188 GE11945-PA 1..188 6..193 831 77.7 Plus
Dyak\GE11944-PA 191 GE11944-PA 23..191 25..193 633 66.3 Plus
Dyak\GE11946-PA 188 GE11946-PA 10..183 15..188 616 61.5 Plus
Dyak\GE11943-PA 188 GE11943-PA 13..188 13..193 487 48.6 Plus
Dyak\GE11947-PA 168 GE11947-PA 6..167 29..192 460 50 Plus

MIP26111.hyp Sequence

Translation from 2 to 583

> MIP26111.hyp
FHIGQMDSGYSSVLILLAVWLISRCGAARKWEYEPVLILTTSSDDSLIKL
ESSIVRLGRGKFGISARVEWNYDTTEETMVEAVVYRSNSGDESDYKLLPW
AIPKQTFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQPPWPKRTYIGDKC
VFEAEGFPDIVPPGFYKIIFNCTGPDQPSWSFIGIFKIINKMF*

MIP26111.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG18537-PA 188 CG18537-PA 1..188 6..193 1017 100 Plus
CG18536-PA 191 CG18536-PA 9..191 11..193 631 60.7 Plus
CG18538-PA 182 CG18538-PA 17..181 29..192 525 58.3 Plus
CG18539-PB 185 CG18539-PB 6..184 12..192 512 51.4 Plus
CG14502-PD 188 CG14502-PD 13..187 13..192 491 46.7 Plus