Clone MIP26116 Report

Search the DGRC for MIP26116

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:261
Well:16
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptjanB-RA
Protein status:MIP26116.pep: gold
Sequenced Size:586

Clone Sequence Records

MIP26116.complete Sequence

586 bp assembled on 2010-08-20

GenBank Submission: BT125584.1

> MIP26116.complete
TAGCTTTGCAACTGCTCGCACTAAACCTTTTCGGATCTAAATTAATCAGT
TTGTACACAAATTTCGTTTCTTTTCCTTTGGTTAAATAAAATGAAAATGT
TCAAGTCATTGCGTCTGCTTCCTCATATTGTTTCTCCGTTTCAAAAATGT
TACTCAACCGATTTGATAAGTTTGGTAGGCGTTCCCCGGGTCAAGATAAC
CAAGGGTCAGAATCGTTATTTGTTGGTGAATATTCATACGCATGGCTTCA
CGAAGTATGGAAGAGTTATTGTCCGTGGCGCCGATGTTGACAATCACTTG
GCGGTCTTCGACTCGATTTTGGAGGAGCTGGAACCCGAGGGCATATGTGC
CAAAATCCTCGGTGGTGGAAGGATTCTCAACGAGGCAGAAAATAAAAAAA
TTAAGATCTATGGCACCTCCAGGACTTTCGGCGGTGCTGATCACACAAGG
ACAAGGAATATACTTCAAGCGTGGACCACTTATAAGGACTTTAAGATAAC
CGTTAAACAATAAAGTTGCATAAATTTCGAAAATGGAAATTCAGTACTAA
TAAAAAGAAAATAGAATATAAAAAAAAAAAAAAAAA

MIP26116.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25860788..25860943 298..143 780 100 Minus
chr3R 27901430 chr3R 25860399..25860545 569..423 735 100 Minus
chr3R 27901430 chr3R 25861002..25861143 142..1 710 100 Minus
chr3R 27901430 chr3R 25860606..25860730 423..299 625 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30038373..30038528 298..143 780 100 Minus
3R 32079331 3R 30037980..30038130 573..423 755 100 Minus
3R 32079331 3R 30038587..30038728 142..1 710 100 Minus
3R 32079331 3R 30038191..30038315 423..299 625 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29779204..29779359 298..143 780 100 Minus
3R 31820162 3R 29778811..29778961 573..423 755 100 Minus
3R 31820162 3R 29779418..29779559 142..1 710 100 Minus
3R 31820162 3R 29779022..29779146 423..299 625 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:32:59 has no hits.

MIP26116.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:33:39 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25860420..25860544 424..548 100 <- Minus
chr3R 25860606..25860730 299..423 100 <- Minus
chr3R 25860788..25860943 143..298 100 <- Minus
chr3R 25861002..25861143 1..142 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-20 16:06:50 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
janB-RA 1..423 91..513 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:39:35 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
janB-RA 1..423 91..513 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:23 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
janB-RA 1..423 91..513 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:42:38 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
janB-RA 1..423 91..513 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-20 16:06:49 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
janB-RA 11..558 1..548 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:39:35 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
janB-RA 11..558 1..548 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:23 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
janB-RA 1..548 1..548 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:42:38 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
janB-RA 1..548 1..548 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:39 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30038587..30038728 1..142 100   Minus
3R 30038005..30038129 424..548 100 <- Minus
3R 30038191..30038315 299..423 100 <- Minus
3R 30038373..30038528 143..298 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:39 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30038587..30038728 1..142 100   Minus
3R 30038005..30038129 424..548 100 <- Minus
3R 30038191..30038315 299..423 100 <- Minus
3R 30038373..30038528 143..298 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:39 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30038587..30038728 1..142 100   Minus
3R 30038005..30038129 424..548 100 <- Minus
3R 30038191..30038315 299..423 100 <- Minus
3R 30038373..30038528 143..298 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:23 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25864309..25864450 1..142 100   Minus
arm_3R 25863727..25863851 424..548 100 <- Minus
arm_3R 25863913..25864037 299..423 100 <- Minus
arm_3R 25864095..25864250 143..298 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:42:45 Download gff for MIP26116.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29778836..29778960 424..548 100 <- Minus
3R 29779022..29779146 299..423 100 <- Minus
3R 29779204..29779359 143..298 100 <- Minus
3R 29779418..29779559 1..142 100   Minus

MIP26116.pep Sequence

Translation from 90 to 512

> MIP26116.pep
MKMFKSLRLLPHIVSPFQKCYSTDLISLVGVPRVKITKGQNRYLLVNIHT
HGFTKYGRVIVRGADVDNHLAVFDSILEELEPEGICAKILGGGRILNEAE
NKKIKIYGTSRTFGGADHTRTRNILQAWTTYKDFKITVKQ*

MIP26116.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23242-PA 145 GF23242-PA 1..142 1..140 348 49.3 Plus
Dana\GF19996-PA 115 GF19996-PA 7..114 31..138 344 61.1 Plus
Dana\GF22681-PA 146 GF22681-PA 19..140 17..139 202 32.3 Plus
Dana\GF23241-PA 126 GF23241-PA 5..114 27..138 145 35.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\janB-PA 140 GG11971-PA 1..140 1..140 679 89.3 Plus
Dere\ocn-PA 149 GG11972-PA 1..139 1..138 279 41 Plus
Dere\GG25321-PA 146 GG25321-PA 29..140 27..139 205 35.1 Plus
Dere\janA-PA 119 GG11970-PA 5..112 27..136 162 37.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18402-PA 144 GH18402-PA 16..144 12..140 257 40.3 Plus
Dgri\GH25086-PA 134 GH25086-PA 8..128 20..139 198 31.4 Plus
Dgri\GH18401-PA 122 GH18401-PA 5..115 27..136 154 34.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
janB-PA 140 CG7931-PA 1..140 1..140 729 100 Plus
ocn-PA 148 CG7929-PA 1..137 1..136 306 43.1 Plus
CG18662-PA 146 CG18662-PA 29..137 27..136 198 36.9 Plus
janA-PA 119 CG7933-PA 5..114 27..138 163 36.8 Plus
janA-PC 119 CG7933-PC 5..114 27..138 163 36.8 Plus
janA-PB 135 CG7933-PB 21..130 27..138 163 36.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17452-PA 148 GI17452-PA 22..142 20..139 199 33.1 Plus
Dmoj\GI23391-PA 123 GI23391-PA 7..116 24..136 163 36.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20557-PA 140 GL20557-PA 1..140 1..140 289 37.9 Plus
Dper\GL26233-PA 149 GL26233-PA 23..144 19..140 177 31.5 Plus
Dper\GL13482-PA 124 GL13482-PA 5..117 27..136 138 32.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20697-PB 140 GA20697-PB 1..140 1..140 291 37.9 Plus
Dpse\GA15041-PA 149 GA15041-PA 23..144 19..140 178 31.5 Plus
Dpse\janA-PB 149 GA20699-PB 30..142 27..136 139 32.2 Plus
Dpse\janA-PA 124 GA20699-PA 5..117 27..136 138 32.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\janB-PA 140 GM12188-PA 1..140 1..140 707 94.3 Plus
Dsec\ocn-PA 148 GM12189-PA 1..139 1..138 319 43.2 Plus
Dsec\GM17315-PA 146 GM17315-PA 29..140 27..139 204 35.1 Plus
Dsec\janA-PA 119 GM12187-PA 5..114 27..138 159 36 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\janB-PA 138 GD17410-PA 1..138 3..140 700 94.9 Plus
Dsim\ocn-PA 148 GD17421-PA 1..139 1..138 319 43.2 Plus
Dsim\GD23579-PA 146 GD23579-PA 29..140 27..139 204 35.1 Plus
Dsim\janA-PA 119 GD17399-PA 5..114 27..138 159 36 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14340-PA 149 GJ14340-PA 14..143 11..139 208 33.1 Plus
Dvir\GJ10386-PA 122 GJ10386-PA 5..115 27..136 169 38.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13426-PA 118 GK13426-PA 6..116 28..138 253 41.4 Plus
Dwil\GK15329-PA 146 GK15329-PA 30..140 28..139 198 31.9 Plus
Dwil\GK13425-PA 124 GK13425-PA 5..117 27..136 144 36.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\janB-PA 138 GE23420-PA 1..138 3..140 665 89.9 Plus
Dyak\ocn-PA 149 GE23422-PA 1..139 1..138 309 41.7 Plus
Dyak\GE18815-PA 146 GE18815-PA 29..140 27..139 199 34.2 Plus
Dyak\janA-PA 119 GE23419-PA 5..112 27..136 162 39.3 Plus

MIP26116.hyp Sequence

Translation from 90 to 512

> MIP26116.hyp
MKMFKSLRLLPHIVSPFQKCYSTDLISLVGVPRVKITKGQNRYLLVNIHT
HGFTKYGRVIVRGADVDNHLAVFDSILEELEPEGICAKILGGGRILNEAE
NKKIKIYGTSRTFGGADHTRTRNILQAWTTYKDFKITVKQ*

MIP26116.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
janB-PA 140 CG7931-PA 1..140 1..140 729 100 Plus
ocn-PA 148 CG7929-PA 1..137 1..136 306 43.1 Plus
CG18662-PA 146 CG18662-PA 29..137 27..136 198 36.9 Plus
janA-PA 119 CG7933-PA 5..114 27..138 163 36.8 Plus
janA-PC 119 CG7933-PC 5..114 27..138 163 36.8 Plus