Clone MIP26226 Report

Search the DGRC for MIP26226

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:262
Well:26
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCheB93b-RA
Protein status:MIP26226.pep: gold
Sequenced Size:699

Clone Sequence Records

MIP26226.complete Sequence

699 bp assembled on 2010-08-20

GenBank Submission: BT125586.1

> MIP26226.complete
AAACATGGACCGGCAACAAGTTACACTGCTGAATATCCTTATATCCCTAA
CATTGCAAATAATAAGCCCTTCATTTGCATTAAATCACTTTTTTATTCCT
GAAAGGGAAGAGCTGTTTAGTGAGTGCCTCGACAAGCCAGGATTTTCTTA
CGTGAATGAGTTGGCTGATCTTTCCCGATTTAACCGTAAAAAAGATGCAG
ATGGGGCCATGAATATATCTGGAAACATAACCATGTTATGGGACGTCGAA
CCTTCAAATCGCGTCGCGGTTGAAGTAAACATAGAAAAATTTGAAGGAGG
TACTTGGAATCCAACATTATTCAAAGGAGGTGATAAGGATTTCTGCAAGA
ACTTCTATGATAAGAACACCATTTATTATCCTTTCTCGACAAAACACGTA
ATCAACAAGCAGCAAGTTAAGGACAAATGCATTACAACTCCGGGAACAGT
TTTAGTCCTGGAACCATTTATCCTGAAGATATTAATCAATTTCGCAGTGC
CTCTAAGCCCAGGAATTCACAAGGCTGTCATTATATTTTCTGCATTCGAC
AAATCTGGTGTTAAGCGTCCACGGGACACTTGCATTGAAATTGTTGGCGA
AATAGTGAATATCTGATTATTAATTATTTGTTTTACTATTATTACAACGA
GATATATTAAAACATTTTATTCAGCATAATAAAAAAAAAAAAAAAAAAA

MIP26226.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17232948..17233217 1..270 1305 98.9 Plus
chr3R 27901430 chr3R 17233515..17233749 446..680 1175 100 Plus
chr3R 27901430 chr3R 17233277..17233454 268..445 890 100 Plus
chr3R 27901430 chr3R 17231598..17231753 290..445 240 76.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21409123..21409392 1..270 1350 100 Plus
3R 32079331 3R 21409690..21409927 446..683 1190 100 Plus
3R 32079331 3R 21409452..21409629 268..445 890 100 Plus
3R 32079331 3R 21407787..21407942 290..445 240 76.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21149954..21150223 1..270 1350 100 Plus
3R 31820162 3R 21150521..21150758 446..683 1190 100 Plus
3R 31820162 3R 21150283..21150460 268..445 890 100 Plus
3R 31820162 3R 21148618..21148773 290..445 240 76.9 Plus
Blast to na_te.dros performed 2019-03-15 23:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 5962..5993 80..49 106 81.2 Minus

MIP26226.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:11:49 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17232948..17233215 1..268 98 -> Plus
chr3R 17233278..17233454 269..445 100 -> Plus
chr3R 17233515..17233749 446..680 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-20 16:06:52 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
CheB93b-RA 1..612 5..616 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:39:38 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
CheB93b-RA 1..612 5..616 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:30:56 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
CheB93b-RA 1..612 5..616 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:22 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
CheB93b-RA 1..612 5..616 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-20 16:06:52 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
CheB93b-RA 1..612 5..616 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:39:38 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
CheB93b-RA 1..612 5..616 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:30:56 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
CheB93b-RA 1..680 1..680 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:22 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
CheB93b-RA 1..680 1..680 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:49 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21409690..21409924 446..680 100   Plus
3R 21409453..21409629 269..445 100 -> Plus
3R 21409123..21409390 1..268 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:49 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21409690..21409924 446..680 100   Plus
3R 21409453..21409629 269..445 100 -> Plus
3R 21409123..21409390 1..268 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:49 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21409690..21409924 446..680 100   Plus
3R 21409453..21409629 269..445 100 -> Plus
3R 21409123..21409390 1..268 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:30:56 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17234845..17235112 1..268 100 -> Plus
arm_3R 17235175..17235351 269..445 100 -> Plus
arm_3R 17235412..17235646 446..680 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:42:48 Download gff for MIP26226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21149954..21150221 1..268 100 -> Plus
3R 21150284..21150460 269..445 100 -> Plus
3R 21150521..21150755 446..680 100   Plus

MIP26226.hyp Sequence

Translation from 0 to 615

> MIP26226.hyp
NMDRQQVTLLNILISLTLQIISPSFALNHFFIPEREELFSECLDKPGFSY
VNELADLSRFNRKKDADGAMNISGNITMLWDVEPSNRVAVEVNIEKFEGG
TWNPTLFKGGDKDFCKNFYDKNTIYYPFSTKHVINKQQVKDKCITTPGTV
LVLEPFILKILINFAVPLSPGIHKAVIIFSAFDKSGVKRPRDTCIEIVGE
IVNI*

MIP26226.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:37
Subject Length Description Subject Range Query Range Score Percent Strand
CheB93b-PA 203 CG31438-PA 1..203 2..204 1061 100 Plus
CheB93a-PA 200 CG15503-PA 16..199 19..203 604 58.4 Plus
CheB42b-PA 196 CG33351-PA 2..191 12..200 345 36.6 Plus
CheB98a-PB 197 CG14531-PB 29..195 36..204 344 40 Plus
CheB38a-PA 197 CG33320-PA 11..196 20..204 338 36.9 Plus

MIP26226.pep Sequence

Translation from 1 to 615

> MIP26226.pep
NMDRQQVTLLNILISLTLQIISPSFALNHFFIPEREELFSECLDKPGFSY
VNELADLSRFNRKKDADGAMNISGNITMLWDVEPSNRVAVEVNIEKFEGG
TWNPTLFKGGDKDFCKNFYDKNTIYYPFSTKHVINKQQVKDKCITTPGTV
LVLEPFILKILINFAVPLSPGIHKAVIIFSAFDKSGVKRPRDTCIEIVGE
IVNI*

MIP26226.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11760-PA 198 GF11760-PA 13..197 21..204 331 37.1 Plus
Dana\GF11757-PA 196 GF11757-PA 16..193 25..201 305 33 Plus
Dana\GF13150-PA 200 GF13150-PA 20..195 26..199 289 36.9 Plus
Dana\GF19949-PA 204 GF19949-PA 34..201 36..204 260 31.8 Plus
Dana\GF18601-PA 165 GF18601-PA 31..145 34..148 256 40.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:16:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24631-PA 200 GG24631-PA 16..199 19..203 623 61.6 Plus
Dere\GG15791-PA 202 GG15791-PA 28..201 31..204 360 37.1 Plus
Dere\GG11613-PA 197 GG11613-PA 3..195 10..204 338 35.2 Plus
Dere\GG11614-PA 198 GG11614-PA 6..191 16..204 336 34.7 Plus
Dere\GG10786-PA 196 GG10786-PA 2..195 12..204 325 34.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11359-PA 200 GH11359-PA 11..197 14..201 308 35.4 Plus
Dgri\GH11360-PA 193 GH11360-PA 3..193 13..204 293 32.6 Plus
Dgri\GH19860-PA 198 GH19860-PA 6..195 12..201 288 31.8 Plus
Dgri\GH19861-PA 1785 GH19861-PA 6..196 12..200 265 31.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
CheB93b-PA 203 CG31438-PA 1..203 2..204 1061 100 Plus
CheB93a-PA 200 CG15503-PA 16..199 19..203 604 58.4 Plus
CheB42b-PA 196 CG33351-PA 2..191 12..200 345 36.6 Plus
CheB98a-PB 197 CG14531-PB 29..195 36..204 344 40 Plus
CheB38a-PA 197 CG33320-PA 11..196 20..204 338 36.9 Plus
CheB74a-PA 202 CG33924-PA 1..201 2..204 338 35.3 Plus
CheB53a-PA 226 CG33550-PA 6..189 16..199 321 32.4 Plus
CheB38c-PA 198 CG14405-PA 17..196 26..204 294 31.5 Plus
CheB53b-PA 204 CG33524-PA 1..197 2..200 290 30 Plus
CheB42c-PB 196 CG33350-PB 14..195 24..204 282 32.8 Plus
CheB42a-PA 198 CG33348-PA 27..193 34..199 272 33.9 Plus
CheB38b-PA 197 CG33321-PA 5..196 13..204 240 26.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24073-PA 201 GI24073-PA 17..196 20..200 294 35.5 Plus
Dmoj\GI19808-PA 199 GI19808-PA 18..195 25..200 277 31.8 Plus
Dmoj\GI18506-PA 196 GI18506-PA 17..193 24..201 259 31.7 Plus
Dmoj\GI23608-PA 200 GI23608-PA 8..197 9..201 254 29.7 Plus
Dmoj\GI24062-PA 146 GI24062-PA 1..141 54..200 219 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13801-PA 200 GL13801-PA 12..200 16..204 382 41.1 Plus
Dper\GL27150-PA 201 GL27150-PA 1..201 2..204 378 38.2 Plus
Dper\GL11129-PA 202 GL11129-PA 8..202 12..204 327 34.9 Plus
Dper\GL10962-PA 197 GL10962-PA 16..192 25..200 314 33.7 Plus
Dper\GL27336-PA 199 GL27336-PA 19..196 24..202 242 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13057-PA 200 GA13057-PA 12..200 16..204 387 41.6 Plus
Dpse\GA16252-PA 201 GA16252-PA 1..201 2..204 374 37.7 Plus
Dpse\GA24619-PA 202 GA24619-PA 8..202 12..204 331 35.4 Plus
Dpse\GA24546-PA 197 GA24546-PA 16..192 25..200 313 33.7 Plus
Dpse\GA26798-PB 205 GA26798-PB 27..200 26..200 264 34.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10426-PA 203 GM10426-PA 1..203 2..204 906 86.7 Plus
Dsec\GM10425-PA 167 GM10425-PA 1..166 27..203 503 54.2 Plus
Dsec\GM20836-PA 196 GM20836-PA 2..191 12..200 333 35.1 Plus
Dsec\GM24315-PA 202 GM24315-PA 1..201 2..204 332 33.3 Plus
Dsec\GM21699-PA 195 GM21699-PA 6..189 16..199 321 34.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19426-PA 203 GD19426-PA 1..203 2..204 919 88.2 Plus
Dsim\GD19425-PA 177 GD19425-PA 1..176 27..203 575 59.3 Plus
Dsim\GD21381-PA 197 GD21381-PA 29..195 36..204 373 45.9 Plus
Dsim\GD10289-PA 196 GD10289-PA 2..191 12..200 328 34 Plus
Dsim\GD21677-PA 198 GD21677-PA 4..196 13..204 327 35.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23975-PA 200 GJ23975-PA 8..197 7..201 325 41.1 Plus
Dvir\GJ18474-PA 199 GJ18474-PA 5..195 12..200 304 32.8 Plus
Dvir\GJ23996-PA 200 GJ23996-PA 8..196 7..200 292 35.7 Plus
Dvir\GJ23997-PA 200 GJ23997-PA 8..197 7..201 286 37.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21541-PA 201 GK21541-PA 9..194 13..201 341 35.8 Plus
Dwil\GK12101-PA 208 GK12101-PA 7..198 13..202 300 34.7 Plus
Dwil\GK21768-PA 205 GK21768-PA 5..202 10..201 271 31.8 Plus
Dwil\GK10987-PA 200 GK10987-PA 1..194 2..200 265 29.7 Plus
Dwil\GK18906-PA 203 GK18906-PA 30..197 37..202 254 33.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25737-PA 203 GE25737-PA 1..203 2..204 774 76.4 Plus
Dyak\GE25735-PA 115 GE25735-PA 1..115 90..204 501 79.1 Plus
Dyak\GE23800-PA 197 GE23800-PA 29..195 36..204 359 40 Plus
Dyak\GE23801-PA 198 GE23801-PA 5..192 13..204 337 37.3 Plus
Dyak\GE24356-PA 196 GE24356-PA 2..191 12..200 326 34.6 Plus