Clone MIP26419 Report

Search the DGRC for MIP26419

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:264
Well:19
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCheB42b-RA
Protein status:MIP26419.pep: gold
Sequenced Size:703

Clone Sequence Records

MIP26419.complete Sequence

703 bp assembled on 2010-08-20

GenBank Submission: BT125593.1

> MIP26419.complete
ATGGTCATCATGATATTTGTGCTGCTACTCTTATTAGGAGTGACCAGTTC
CTGGGCCACAGACTATGAATTATTGCTCGAGGATCCGGACATATTTTCGA
CGTGCACTGATGGTCCTCCCGGATCCATCAACATCCGCCAGGCACTCAAC
TTAGACGACATTGTAATCGACCAGAAAGGGGATATACTTCATGTATCCGG
GAACGCCACCGTCGTGTGGGATGTGCAGCCCACCGATCGGATTACTGCGA
GACTTGATGTTTTTCACTTCAACCGCGGCACTTGGGAGCCCACTGTCTTT
AGCATGGCCACCCAGAACTTTTGCTCCATCATGTACGACAAGAACCAGTA
TTGGTATAAGTATTGGACAAGGTTTATAACCAATCGCCATGAGGTGGAAA
AGAAGTGCTTCAGAGGGCCTGATACCGTTCTGGTACACGAGCCCTTCGAT
CTCATACTAAAATTTGAGAATTTTCGTGGACCTCTTCTTAGAGGACGTCA
TAAACTTGTCATATTGTTTAACGCACTAGATGAGAGGAATATACCGCGCC
CAAACCCAATTTGTTTGGAGATCATAGGAGAACCACTAAAGTTGCAGTAG
TTGGAACAATAGACTATTTTGTTGAATGTGTATTTTTTTTTTTCAATATT
GTATAATATTAAACATAGTGTTCTTAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

MIP26419.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2831134..2831380 247..1 1220 99.6 Minus
chr2R 21145070 chr2R 2830481..2830731 675..424 1210 99.6 Minus
chr2R 21145070 chr2R 2830892..2831068 423..247 885 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6943749..6943995 247..1 1235 100 Minus
2R 25286936 2R 6943094..6943346 677..424 1220 99.6 Minus
2R 25286936 2R 6943507..6943683 423..247 885 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6944948..6945194 247..1 1235 100 Minus
2R 25260384 2R 6944293..6944545 677..424 1230 99.6 Minus
2R 25260384 2R 6944706..6944882 423..247 885 100 Minus
2R 25260384 2R 6946195..6946293 368..270 165 77.7 Minus
Blast to na_te.dros performed on 2019-03-15 17:24:44 has no hits.

MIP26419.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:26:00 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2830481..2830731 424..675 99 <- Minus
chr2R 2830892..2831068 247..423 100 <- Minus
chr2R 2831135..2831380 1..246 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-08-20 16:07:02 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42b-RA 1..591 10..600 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:39:49 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42b-RA 1..591 10..600 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:35:06 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42b-RA 1..591 10..600 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:41 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42b-RA 1..591 10..600 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-20 16:07:02 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42b-RA 1..591 10..600 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:39:49 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42b-RA 1..591 10..600 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:35:06 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42b-RA 1..674 1..675 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:41 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42b-RA 1..674 1..675 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:26:00 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6943750..6943995 1..246 100   Minus
2R 6943096..6943346 424..675 99 <- Minus
2R 6943507..6943683 247..423 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:26:00 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6943750..6943995 1..246 100   Minus
2R 6943096..6943346 424..675 99 <- Minus
2R 6943507..6943683 247..423 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:26:00 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6943750..6943995 1..246 100   Minus
2R 6943096..6943346 424..675 99 <- Minus
2R 6943507..6943683 247..423 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:35:06 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2830601..2830851 424..675 99 <- Minus
arm_2R 2831012..2831188 247..423 100 <- Minus
arm_2R 2831255..2831500 1..246 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:43:00 Download gff for MIP26419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6944295..6944545 424..675 99 <- Minus
2R 6944706..6944882 247..423 100 <- Minus
2R 6944949..6945194 1..246 100   Minus

MIP26419.pep Sequence

Translation from 0 to 599

> MIP26419.pep
MVIMIFVLLLLLGVTSSWATDYELLLEDPDIFSTCTDGPPGSINIRQALN
LDDIVIDQKGDILHVSGNATVVWDVQPTDRITARLDVFHFNRGTWEPTVF
SMATQNFCSIMYDKNQYWYKYWTRFITNRHEVEKKCFRGPDTVLVHEPFD
LILKFENFRGPLLRGRHKLVILFNALDERNIPRPNPICLEIIGEPLKLQ*

MIP26419.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11760-PA 198 GF11760-PA 7..198 8..199 743 68.8 Plus
Dana\GF11757-PA 196 GF11757-PA 7..196 9..198 630 55.3 Plus
Dana\GF13150-PA 200 GF13150-PA 20..195 19..193 312 36.2 Plus
Dana\GF19949-PA 204 GF19949-PA 27..202 22..199 283 32.2 Plus
Dana\GF19882-PA 257 GF19882-PA 6..140 2..136 247 31.9 Plus
Dana\GF19882-PA 257 GF19882-PA 145..251 83..191 212 40.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10786-PA 196 GG10786-PA 1..196 4..199 899 81.6 Plus
Dere\GG10785-PA 196 GG10785-PA 1..196 4..199 631 55.1 Plus
Dere\GG21546-PA 198 GG21546-PA 5..197 7..199 484 43 Plus
Dere\GG21547-PA 197 GG21547-PA 5..192 7..194 476 43.1 Plus
Dere\GG15791-PA 202 GG15791-PA 11..202 7..199 413 38.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19861-PA 1785 GH19861-PA 1..196 5..194 521 47.4 Plus
Dgri\GH19860-PA 198 GH19860-PA 6..194 8..194 462 46.3 Plus
Dgri\GH11359-PA 200 GH11359-PA 7..196 3..194 385 38 Plus
Dgri\GH11360-PA 193 GH11360-PA 1..193 4..198 357 35.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
CheB42b-PA 196 CG33351-PA 1..196 4..199 1058 100 Plus
CheB42c-PB 196 CG33350-PB 4..195 7..198 633 56.8 Plus
CheB38c-PA 198 CG14405-PA 5..197 7..199 524 46.1 Plus
CheB38b-PA 197 CG33321-PA 5..192 7..194 485 42 Plus
CheB38a-PA 197 CG33320-PA 7..197 9..199 477 43.5 Plus
CheB74a-PA 202 CG33924-PA 7..202 3..199 386 36.5 Plus
CheB42a-PA 198 CG33348-PA 7..193 7..193 363 35.6 Plus
CheB53b-PA 204 CG33524-PA 11..197 7..194 361 37.2 Plus
CheB53a-PA 226 CG33550-PA 1..189 4..193 358 37.4 Plus
CheB98a-PB 197 CG14531-PB 22..196 22..199 346 38.2 Plus
CheB93b-PA 203 CG31438-PA 8..199 2..194 346 36.1 Plus
CheB93a-PA 200 CG15503-PA 7..196 3..194 286 29.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19808-PA 199 GI19808-PA 19..199 19..198 527 49.7 Plus
Dmoj\GI24073-PA 201 GI24073-PA 11..200 7..198 417 39.6 Plus
Dmoj\GI23608-PA 200 GI23608-PA 13..200 8..198 340 35.6 Plus
Dmoj\GI18506-PA 196 GI18506-PA 9..196 8..198 330 34.6 Plus
Dmoj\GI24062-PA 146 GI24062-PA 3..146 50..199 310 40.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10962-PA 197 GL10962-PA 5..197 7..199 652 57 Plus
Dper\GL27150-PA 201 GL27150-PA 11..201 7..198 427 38.5 Plus
Dper\GL13801-PA 200 GL13801-PA 5..200 2..198 405 39.6 Plus
Dper\GL11129-PA 202 GL11129-PA 8..197 5..193 380 39.8 Plus
Dper\GL27336-PA 199 GL27336-PA 24..197 22..197 339 37.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24546-PA 197 GA24546-PA 5..197 7..199 655 57.5 Plus
Dpse\GA16252-PA 201 GA16252-PA 11..201 7..198 434 39.6 Plus
Dpse\GA13057-PA 200 GA13057-PA 5..200 2..198 418 40.6 Plus
Dpse\GA24619-PA 202 GA24619-PA 8..197 5..193 387 40.8 Plus
Dpse\GA27041-PA 199 GA27041-PA 24..197 22..197 338 37.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20836-PA 196 GM20836-PA 1..196 4..199 978 91.8 Plus
Dsec\GM20835-PA 196 GM20835-PA 1..196 4..199 623 55.1 Plus
Dsec\GM23304-PA 197 GM23304-PA 5..192 7..194 491 42.6 Plus
Dsec\GM23303-PA 195 GM23303-PA 1..194 3..199 433 40.6 Plus
Dsec\GM24315-PA 202 GM24315-PA 7..202 3..199 413 39.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10289-PA 196 GD10289-PA 1..196 4..199 978 91.8 Plus
Dsim\GD10288-PA 196 GD10288-PA 1..196 4..199 633 56.1 Plus
Dsim\GD21677-PA 198 GD21677-PA 7..197 9..199 490 44.5 Plus
Dsim\GD21678-PA 197 GD21678-PA 5..192 7..194 483 42.6 Plus
Dsim\GD21676-PA 166 GD21676-PA 5..165 7..199 398 38.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18474-PA 199 GJ18474-PA 1..199 4..198 571 51.8 Plus
Dvir\GJ23975-PA 200 GJ23975-PA 7..200 1..198 391 39.9 Plus
Dvir\GJ23997-PA 200 GJ23997-PA 11..200 7..198 387 39.1 Plus
Dvir\GJ23996-PA 200 GJ23996-PA 11..200 7..198 385 38 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21541-PA 201 GK21541-PA 1..198 1..199 570 52.3 Plus
Dwil\GK12101-PA 208 GK12101-PA 8..199 7..197 416 40.9 Plus
Dwil\GK10987-PA 200 GK10987-PA 4..197 3..197 337 33.2 Plus
Dwil\GK18906-PA 203 GK18906-PA 1..198 1..197 298 29.1 Plus
Dwil\GK21768-PA 205 GK21768-PA 5..205 3..198 260 30.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24356-PA 196 GE24356-PA 1..196 4..199 912 83.2 Plus
Dyak\GE24346-PA 196 GE24346-PA 1..196 4..199 641 57.1 Plus
Dyak\GE13540-PA 197 GE13540-PA 5..197 7..199 502 44 Plus
Dyak\GE13541-PA 197 GE13541-PA 5..192 7..194 476 42.6 Plus
Dyak\GE23801-PA 198 GE23801-PA 6..193 7..199 392 39.9 Plus

MIP26419.hyp Sequence

Translation from 1 to 599

> MIP26419.hyp
MVIMIFVLLLLLGVTSSWATDYELLLEDPDIFSTCTDGPPGSINIRQALN
LDDIVIDQKGDILHVSGNATVVWDVQPTDRITARLDVFHFNRGTWEPTVF
SMATQNFCSIMYDKNQYWYKYWTRFITNRHEVEKKCFRGPDTVLVHEPFD
LILKFENFRGPLLRGRHKLVILFNALDERNIPRPNPICLEIIGEPLKLQ*

MIP26419.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:01
Subject Length Description Subject Range Query Range Score Percent Strand
CheB42b-PA 196 CG33351-PA 1..196 4..199 1058 100 Plus
CheB42c-PB 196 CG33350-PB 4..195 7..198 633 56.8 Plus
CheB38c-PA 198 CG14405-PA 5..197 7..199 524 46.1 Plus
CheB38b-PA 197 CG33321-PA 5..192 7..194 485 42 Plus
CheB38a-PA 197 CG33320-PA 7..197 9..199 477 43.5 Plus