Clone Sequence Records
MIP29112.complete Sequence
254 bp assembled on 2011-03-01
GenBank Submission: BT126269.1
> MIP29112.complete
AAATGTTGACGCTTACACTTGGATTTGCGATGCAGTTGCTGCTGTTGATT
TCGCTGCTACTGCTACTTCCACTGCCCGGATTTTCGAGAGAACTAAGGCA
GCCCTATAGATACGACAGATACGACGGTAATCCTGGCCAAAACCAACCAA
GGAATTTGGAGCGGAACTGATATGCATAACTAAAACGGGTTCCAAAAGAA
ACACAATAAACTAGCGTAACACGAAGGCATCAAAAAAAAAAAAAAAAAAA
AAAA
MIP29112.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:46:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 14917138..14917368 | 1..231 | 1140 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 19030020..19030250 | 1..231 | 1155 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:02:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 19031219..19031449 | 1..231 | 1155 | 100 | Plus |
Blast to na_te.dros performed 2019-03-17 01:46:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
roo | 9092 | roo DM_ROO 9092bp | 1084..1135 | 75..25 | 122 | 73.1 | Minus |
roo | 9092 | roo DM_ROO 9092bp | 1099..1153 | 75..19 | 118 | 72.4 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6814..6885 | 75..4 | 117 | 62.5 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2326..2386 | 64..4 | 116 | 65.6 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2347..2393 | 64..19 | 115 | 74.5 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6712..6770 | 87..29 | 106 | 64.4 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2783..2823 | 69..29 | 106 | 73.2 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2306..2340 | 63..29 | 103 | 77.1 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2824..2887 | 67..4 | 103 | 66.2 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2626..2685 | 67..5 | 101 | 65.1 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 6847..6892 | 69..25 | 101 | 71.7 | Minus |
roo | 9092 | roo DM_ROO 9092bp | 1105..1151 | 75..29 | 100 | 68.1 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2805..2842 | 62..25 | 100 | 73.7 | Minus |
MIP29112.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:47:33 Download gff for
MIP29112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 14917138..14917368 | 1..231 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:24 Download gff for
MIP29112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43351-RA | 1..168 | 3..170 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:50 Download gff for
MIP29112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43351-RA | 1..168 | 3..170 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 11:11:35 Download gff for
MIP29112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42725-RA | 1..221 | 1..221 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:24 Download gff for
MIP29112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43351-RA | 12..242 | 1..231 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:50 Download gff for
MIP29112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43351-RA | 12..242 | 1..231 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:33 Download gff for
MIP29112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19030020..19030250 | 1..231 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:33 Download gff for
MIP29112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19030020..19030250 | 1..231 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:33 Download gff for
MIP29112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19030020..19030250 | 1..231 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:24 Download gff for
MIP29112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14917525..14917755 | 1..231 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:49:30 Download gff for
MIP29112.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 19031219..19031449 | 1..231 | 100 | | Plus |
MIP29112.hyp Sequence
Translation from 2 to 169
> MIP29112.hyp
MLTLTLGFAMQLLLLISLLLLLPLPGFSRELRQPYRYDRYDGNPGQNQPR
NLERN*
MIP29112.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43351-PA | 55 | CG43351-PA | 1..55 | 1..55 | 284 | 100 | Plus |
MIP29112.pep Sequence
Translation from 2 to 169
> MIP29112.pep
MLTLTLGFAMQLLLLISLLLLLPLPGFSRELRQPYRYDRYDGNPGQNQPR
NLERN*
MIP29112.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43351-PA | 55 | CG43351-PA | 1..55 | 1..55 | 284 | 100 | Plus |