Clone MIP29112 Report

Search the DGRC for MIP29112

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:291
Well:12
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43351-RA
Protein status:MIP29112.pep: gold
Sequenced Size:254

Clone Sequence Records

MIP29112.complete Sequence

254 bp assembled on 2011-03-01

GenBank Submission: BT126269.1

> MIP29112.complete
AAATGTTGACGCTTACACTTGGATTTGCGATGCAGTTGCTGCTGTTGATT
TCGCTGCTACTGCTACTTCCACTGCCCGGATTTTCGAGAGAACTAAGGCA
GCCCTATAGATACGACAGATACGACGGTAATCCTGGCCAAAACCAACCAA
GGAATTTGGAGCGGAACTGATATGCATAACTAAAACGGGTTCCAAAAGAA
ACACAATAAACTAGCGTAACACGAAGGCATCAAAAAAAAAAAAAAAAAAA
AAAA

MIP29112.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14917138..14917368 1..231 1140 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19030020..19030250 1..231 1155 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19031219..19031449 1..231 1155 100 Plus
Blast to na_te.dros performed 2019-03-17 01:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1084..1135 75..25 122 73.1 Minus
roo 9092 roo DM_ROO 9092bp 1099..1153 75..19 118 72.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6814..6885 75..4 117 62.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2326..2386 64..4 116 65.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2347..2393 64..19 115 74.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6712..6770 87..29 106 64.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2783..2823 69..29 106 73.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2340 63..29 103 77.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2824..2887 67..4 103 66.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2626..2685 67..5 101 65.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6847..6892 69..25 101 71.7 Minus
roo 9092 roo DM_ROO 9092bp 1105..1151 75..29 100 68.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2805..2842 62..25 100 73.7 Minus

MIP29112.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:47:33 Download gff for MIP29112.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14917138..14917368 1..231 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:24 Download gff for MIP29112.complete
Subject Subject Range Query Range Percent Splice Strand
CG43351-RA 1..168 3..170 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:50 Download gff for MIP29112.complete
Subject Subject Range Query Range Percent Splice Strand
CG43351-RA 1..168 3..170 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 11:11:35 Download gff for MIP29112.complete
Subject Subject Range Query Range Percent Splice Strand
CG42725-RA 1..221 1..221 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:24 Download gff for MIP29112.complete
Subject Subject Range Query Range Percent Splice Strand
CG43351-RA 12..242 1..231 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:50 Download gff for MIP29112.complete
Subject Subject Range Query Range Percent Splice Strand
CG43351-RA 12..242 1..231 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:33 Download gff for MIP29112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19030020..19030250 1..231 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:33 Download gff for MIP29112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19030020..19030250 1..231 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:33 Download gff for MIP29112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19030020..19030250 1..231 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:24 Download gff for MIP29112.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14917525..14917755 1..231 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:49:30 Download gff for MIP29112.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19031219..19031449 1..231 100   Plus

MIP29112.hyp Sequence

Translation from 2 to 169

> MIP29112.hyp
MLTLTLGFAMQLLLLISLLLLLPLPGFSRELRQPYRYDRYDGNPGQNQPR
NLERN*

MIP29112.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG43351-PA 55 CG43351-PA 1..55 1..55 284 100 Plus

MIP29112.pep Sequence

Translation from 2 to 169

> MIP29112.pep
MLTLTLGFAMQLLLLISLLLLLPLPGFSRELRQPYRYDRYDGNPGQNQPR
NLERN*

MIP29112.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG43351-PA 55 CG43351-PA 1..55 1..55 284 100 Plus