Clone MIP29126 Report

Search the DGRC for MIP29126

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:291
Well:26
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43072-RA
Protein status:MIP29126.pep: gold
Sequenced Size:409

Clone Sequence Records

MIP29126.complete Sequence

409 bp assembled on 2011-03-07

GenBank Submission: BT126247.1

> MIP29126.complete
CAAGTTTTAGTTATTTTTGTCTAAATTTTGTATAAATTTTTGGCCGTCAC
CTGGCATCATTGACTGAAAAATTAAAAAAAAAAGGATGACCATGGAACTG
CTTGCGCGGCACAATCTTCAGAAGGTTGAACAGCTCACGACCTTCGATCT
GAAATATTTCTTTATCATCTACGCCATCGTCGTCCTGATGATCCTGGGTG
TTCCACTGGCCTTCCTACTTCAAAGCAAGGGTTCGGCGAACGAAAGGGAT
CGTTTTCAATTGGAAGCCAATCGATCGCGCGTGGATCCAGTGAGGGGAGA
AACCCGGCGACGAATCCGGGATTCGAGTGCCTAATAAGCTTTTGATATTG
ATGTTGATATTCATGGAAATACATTGAATGCGGCGCAAAAAAAAAAAAAA
AAAAAAAAA

MIP29126.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21054866..21055252 1..386 1885 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21065852..21066240 1..388 1895 99.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21058952..21059340 1..388 1905 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 22:18:51 has no hits.

MIP29126.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:36 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21054866..21055252 1..386 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-07 14:21:04 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 1..249 86..334 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:53:53 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 1..249 86..334 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:20 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 1..249 86..334 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-07 14:21:03 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 1..249 86..334 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:53:53 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 1..387 1..386 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:20 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
CG43072-RA 1..387 1..386 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:36 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21065852..21066238 1..386 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:36 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21065852..21066238 1..386 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:36 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21065852..21066238 1..386 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:53:53 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21058952..21059338 1..386 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:41 Download gff for MIP29126.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21058952..21059338 1..386 99   Plus

MIP29126.pep Sequence

Translation from 85 to 333

> MIP29126.pep
MTMELLARHNLQKVEQLTTFDLKYFFIIYAIVVLMILGVPLAFLLQSKGS
ANERDRFQLEANRSRVDPVRGETRRRIRDSSA*

MIP29126.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG43072-PA 82 CG43072-PA 1..82 1..82 403 100 Plus

MIP29126.hyp Sequence

Translation from 85 to 333

> MIP29126.hyp
MTMELLARHNLQKVEQLTTFDLKYFFIIYAIVVLMILGVPLAFLLQSKGS
ANERDRFQLEANRSRVDPVRGETRRRIRDSSA*

MIP29126.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG43072-PA 82 CG43072-PA 1..82 1..82 403 100 Plus