Clone MIP29153 Report

Search the DGRC for MIP29153

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:291
Well:53
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42535-RA
Protein status:MIP29153.pep: gold
Sequenced Size:678

Clone Sequence Records

MIP29153.complete Sequence

678 bp assembled on 2011-03-01

GenBank Submission: BT126105.1

> MIP29153.complete
ATTGGATGTGGAAAATTAACCTTGTGCCCACAATGGGCACCGAAAAGAAA
AAACACCCGCCAAAAAAGAAGTCACAGGAGAAAAAAAAGAGCGGTCATAG
CAAGTCGAAGCAGAATTCTTTGAATTCCAATCTGCCCAAGATATGTTTCG
TCATAGCAATTTTCGATCTGCTGCATGCGTTATATTTTACAGTTCAAGCA
ATGATTCTTCTGGTTAAACAGTTCAGCGCGTTTGCTATGTTGGCGCTTTT
GGGTGTCATTTTTTGGGTTATAATGGTCATCCTGTTGATGGTTGGCCTTT
ATAAGCGCAAGCCAGTTTTCGTAAGGTATTGGCTTATATTTTCCATAGTC
GGCTTTATAACCGATATTCTATTTCTACTTTGGGGCATTGCGACCTCAAT
AACTGTGGACTGGGACCGTCTTAATGAGTTTTCAATAATTTTCCTTGGAA
TATTTGTTGAAAGCGCCTGCATATATTTCATACATCGGTACTATCAGATT
ATGGATGAATCGAAAAAGAAGAGGACCCTATGTTGTGGCGGAAAAAACGA
AAAGAAAAAGTCTAAAAGCCCAAAAAAGAAGAAAGGCAAAAAATAAGATC
TTTCAACTTTAGTTGGCTTTGTATTTCCGTACTAAAAAAATATATATTTA
TTAGATTGTTTCAAAAAAAAAAAAAAAA

MIP29153.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10622091..10622313 221..1 1035 98.7 Minus
chr3L 24539361 chr3L 10621741..10621890 453..304 735 99.3 Minus
chr3L 24539361 chr3L 10621420..10621549 662..535 570 97.7 Minus
chr3L 24539361 chr3L 10621601..10621683 536..454 415 100 Minus
chr3L 24539361 chr3L 10621946..10622031 305..220 370 95.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10630703..10630925 221..1 1050 99.1 Minus
3L 28110227 3L 10630353..10630502 453..304 750 100 Minus
3L 28110227 3L 10630031..10630161 665..535 655 100 Minus
3L 28110227 3L 10630558..10630643 305..220 430 100 Minus
3L 28110227 3L 10630213..10630295 536..454 415 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10623803..10624025 221..1 1060 99.1 Minus
3L 28103327 3L 10623453..10623602 453..304 750 100 Minus
3L 28103327 3L 10623131..10623261 665..535 655 100 Minus
3L 28103327 3L 10623658..10623743 305..220 430 100 Minus
3L 28103327 3L 10623313..10623395 536..454 415 100 Minus
Blast to na_te.dros performed on 2019-03-17 01:45:19 has no hits.

MIP29153.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:45:59 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10621741..10621888 306..453 99 <- Minus
chr3L 10621946..10622029 222..305 95 <- Minus
chr3L 10622091..10622313 1..221 98   Minus
chr3L 10621456..10621549 535..628 98 <- Minus
chr3L 10621603..10621683 454..534 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 10:32:28 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
CG42535-RA 1..564 33..596 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:51:47 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
CG42535-RA 1..564 33..596 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:05 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
CG42535-RA 1..564 33..596 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 10:32:28 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
CG42535-RA 11..608 1..596 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:51:47 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
CG42535-RA 11..674 1..662 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:05 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
CG42535-RA 11..674 1..662 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:59 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10630034..10630161 535..662 100 <- Minus
3L 10630215..10630295 454..534 100 <- Minus
3L 10630353..10630500 306..453 100 <- Minus
3L 10630558..10630641 222..305 100 <- Minus
3L 10630703..10630925 1..221 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:59 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10630034..10630161 535..662 100 <- Minus
3L 10630215..10630295 454..534 100 <- Minus
3L 10630353..10630500 306..453 100 <- Minus
3L 10630558..10630641 222..305 100 <- Minus
3L 10630703..10630925 1..221 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:59 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10630034..10630161 535..662 100 <- Minus
3L 10630215..10630295 454..534 100 <- Minus
3L 10630353..10630500 306..453 100 <- Minus
3L 10630558..10630641 222..305 100 <- Minus
3L 10630703..10630925 1..221 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:51:47 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10623134..10623261 535..662 100 <- Minus
arm_3L 10623315..10623395 454..534 100 <- Minus
arm_3L 10623453..10623600 306..453 100 <- Minus
arm_3L 10623658..10623741 222..305 100 <- Minus
arm_3L 10623803..10624025 1..221 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:06 Download gff for MIP29153.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10623803..10624025 1..221 99   Minus
3L 10623134..10623261 535..662 100 <- Minus
3L 10623315..10623395 454..534 100 <- Minus
3L 10623453..10623600 306..453 100 <- Minus
3L 10623658..10623741 222..305 100 <- Minus

MIP29153.pep Sequence

Translation from 5 to 595

> MIP29153.pep
MWKINLVPTMGTEKKKHPPKKKSQEKKKSGHSKSKQNSLNSNLPKICFVI
AIFDLLHALYFTVQAMILLVKQFSAFAMLALLGVIFWVIMVILLMVGLYK
RKPVFVRYWLIFSIVGFITDILFLLWGIATSITVDWDRLNEFSIIFLGIF
VESACIYFIHRYYQIMDESKKKRTLCCGGKNEKKKSKSPKKKKGKK*

MIP29153.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-17 01:21:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23826-PA 199 GF23826-PA 14..171 48..196 198 33.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-17 01:21:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13969-PA 197 GG13969-PA 6..152 40..176 200 27.9 Plus
Dere\GG15439-PA 206 GG15439-PA 11..134 40..163 145 26.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-17 01:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16545-PA 196 GH16545-PA 11..169 46..196 168 28.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG42535-PA 187 CG42535-PA 1..187 10..196 970 100 Plus
CG42536-PA 184 CG42536-PA 14..136 42..164 247 35.8 Plus
CG14151-PA 196 CG14151-PA 14..152 48..176 224 31.7 Plus
CG34238-PA 206 CG34238-PA 13..128 48..163 186 27.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-17 01:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13834-PA 407 GI13834-PA 10..152 48..193 178 31.5 Plus
Dmoj\GI13834-PA 407 GI13834-PA 159..353 12..195 161 24.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-17 01:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15591-PA 184 GL15591-PA 22..154 20..187 246 39.9 Plus
Dper\GL15592-PA 134 GL15592-PA 15..125 48..157 139 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-17 01:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23455-PA 212 GA23455-PA 22..156 24..154 350 58.5 Plus
Dpse\GA23456-PA 203 GA23456-PA 14..173 47..196 185 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-17 01:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24805-PA 196 GM24805-PA 6..171 40..196 214 28.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-17 01:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12858-PA 196 GD12858-PA 6..171 40..196 213 28.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-17 01:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11701-PA 410 GJ11701-PA 14..169 48..196 190 28.2 Plus
Dvir\GJ11701-PA 410 GJ11701-PA 164..327 9..166 155 27.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-17 01:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12361-PA 195 GK12361-PA 11..158 48..196 213 30.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-17 01:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20266-PA 130 GE20266-PA 27..109 39..149 351 68.5 Plus
Dyak\GE20268-PA 200 GE20268-PA 6..150 40..188 197 26.8 Plus

MIP29153.hyp Sequence

Translation from 32 to 595

> MIP29153.hyp
MGTEKKKHPPKKKSQEKKKSGHSKSKQNSLNSNLPKICFVIAIFDLLHAL
YFTVQAMILLVKQFSAFAMLALLGVIFWVIMVILLMVGLYKRKPVFVRYW
LIFSIVGFITDILFLLWGIATSITVDWDRLNEFSIIFLGIFVESACIYFI
HRYYQIMDESKKKRTLCCGGKNEKKKSKSPKKKKGKK*

MIP29153.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:15:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG42535-PA 187 CG42535-PA 1..187 1..187 970 100 Plus
CG42536-PA 184 CG42536-PA 14..136 33..155 247 35.8 Plus
CG14151-PA 196 CG14151-PA 14..152 39..167 224 31.7 Plus
CG34238-PA 206 CG34238-PA 13..128 39..154 186 27.6 Plus