Clone MIP29156 Report

Search the DGRC for MIP29156

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:291
Well:56
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptSfp33A4-RA
Protein status:MIP29156.pep: gold
Sequenced Size:274

Clone Sequence Records

MIP29156.complete Sequence

274 bp assembled on 2011-03-01

GenBank Submission: BT126239.1

> MIP29156.complete
ATTATATTCTGCAACGATGCATTGTTATATTCCTATTGCGTTTTGCTTGT
TCGCTCTTTTGGAATTAACAAACGGGGTGAACGAAAAGGAAAGTTCTACC
TATTGTGTATCCTATTTTAATGGTGTATGCTGGGATAAAAGATTTAATAT
GTGGCCCACGGGAAAGTAGATGCGATAAACGCTTGTGACTTGTAATCATG
ATACCAAGTAACTTTCGATAATAAAGTTGGTTATTTTCTTTTTGAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAA

MIP29156.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11835905..11836162 1..244 1045 94.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11837243..11837486 1..244 1220 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11837243..11837486 1..244 1220 100 Plus
Blast to na_te.dros performed on 2019-03-17 01:45:21 has no hits.

MIP29156.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:46:01 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11835905..11836108 1..204 100 <- Plus
chr2L 11836123..11836162 205..244 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 10:32:29 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A4-RA 1..153 17..169 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:51:52 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A4-RA 1..153 17..169 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:08 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A4-RA 1..153 17..169 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 10:32:29 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A4-RA 1..153 17..169 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:51:52 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A4-RA 1..244 1..244 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:08 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A4-RA 1..244 1..244 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:01 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837243..11837486 1..244 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:01 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837243..11837486 1..244 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:01 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837243..11837486 1..244 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:51:52 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11837243..11837486 1..244 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:03 Download gff for MIP29156.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837243..11837486 1..244 100   Plus

MIP29156.hyp Sequence

Translation from 0 to 168

> MIP29156.hyp
LYSATMHCYIPIAFCLFALLELTNGVNEKESSTYCVSYFNGVCWDKRFNM
WPTGK*

MIP29156.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A4-PA 50 CG42604-PA 1..50 6..55 289 100 Plus
Sfp33A2-PA 50 CG42473-PA 1..50 6..55 138 48 Plus

MIP29156.pep Sequence

Translation from 1 to 168

> MIP29156.pep
LYSATMHCYIPIAFCLFALLELTNGVNEKESSTYCVSYFNGVCWDKRFNM
WPTGK*

MIP29156.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A4-PA 50 CG42604-PA 1..50 6..55 289 100 Plus
Sfp33A2-PA 50 CG42473-PA 1..50 6..55 138 48 Plus