MIP29156.complete Sequence
274 bp assembled on 2011-03-01
GenBank Submission: BT126239.1
> MIP29156.complete
ATTATATTCTGCAACGATGCATTGTTATATTCCTATTGCGTTTTGCTTGT
TCGCTCTTTTGGAATTAACAAACGGGGTGAACGAAAAGGAAAGTTCTACC
TATTGTGTATCCTATTTTAATGGTGTATGCTGGGATAAAAGATTTAATAT
GTGGCCCACGGGAAAGTAGATGCGATAAACGCTTGTGACTTGTAATCATG
ATACCAAGTAACTTTCGATAATAAAGTTGGTTATTTTCTTTTTGAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAA
MIP29156.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:45:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 11835905..11836162 | 1..244 | 1045 | 94.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11837243..11837486 | 1..244 | 1220 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:07:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11837243..11837486 | 1..244 | 1220 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-17 01:45:21 has no hits.
MIP29156.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:46:01 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 11835905..11836108 | 1..204 | 100 | <- | Plus |
chr2L | 11836123..11836162 | 205..244 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 10:32:29 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A4-RA | 1..153 | 17..169 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:51:52 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A4-RA | 1..153 | 17..169 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:08 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A4-RA | 1..153 | 17..169 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 10:32:29 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A4-RA | 1..153 | 17..169 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:51:52 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A4-RA | 1..244 | 1..244 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:08 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A4-RA | 1..244 | 1..244 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:01 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11837243..11837486 | 1..244 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:01 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11837243..11837486 | 1..244 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:01 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11837243..11837486 | 1..244 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:51:52 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11837243..11837486 | 1..244 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:03 Download gff for
MIP29156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11837243..11837486 | 1..244 | 100 | | Plus |
MIP29156.hyp Sequence
Translation from 0 to 168
> MIP29156.hyp
LYSATMHCYIPIAFCLFALLELTNGVNEKESSTYCVSYFNGVCWDKRFNM
WPTGK*
MIP29156.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A4-PA | 50 | CG42604-PA | 1..50 | 6..55 | 289 | 100 | Plus |
Sfp33A2-PA | 50 | CG42473-PA | 1..50 | 6..55 | 138 | 48 | Plus |
MIP29156.pep Sequence
Translation from 1 to 168
> MIP29156.pep
LYSATMHCYIPIAFCLFALLELTNGVNEKESSTYCVSYFNGVCWDKRFNM
WPTGK*
MIP29156.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A4-PA | 50 | CG42604-PA | 1..50 | 6..55 | 289 | 100 | Plus |
Sfp33A2-PA | 50 | CG42473-PA | 1..50 | 6..55 | 138 | 48 | Plus |