Clone MIP29172 Report

Search the DGRC for MIP29172

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:291
Well:72
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42833-RA
Protein status:MIP29172.pep: gold
Sequenced Size:421

Clone Sequence Records

MIP29172.complete Sequence

421 bp assembled on 2011-03-01

GenBank Submission: BT126246.1

> MIP29172.complete
AGTTAGAGATCATCGCTGTATCAAAATGCGAGCATCCAGAGGAAATGGAT
TTTCATTTTACTTGATCTTTTCATTGCTGCTAATCTGCAAATTGGAAAGG
ATCTTAGGTGATGTAAGCCCGGCAGATGAGAAATCGATAGAGTCAAATAT
CGTCACAATTTGGGATCGAATTGCAAGCGGAGTTATAAACTATCCCTGGA
AAACTAATATCATTGAGAAGGAGAGCCCAGAAACTACTAAGAGGAGATCG
GTTCTATGGCAAAGACTAACGATGGCCACAGTTCTTTAATGGATACAAGT
ATTGCCTGATTGAAAATGTTAGTAATATGTCAACAAATTTTTATACAATT
CAGTGTGCTTGCTGTATTGCAAAATAAAGAGCCCCTTGTTTATTACAAAA
AAAAAAAAAAAAAAAAAAAAA

MIP29172.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20189280..20189675 1..395 1930 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20200093..20200488 1..395 1930 99.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20193193..20193588 1..395 1940 99.7 Plus
Blast to na_te.dros performed 2019-03-16 22:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy7 5486 gypsy7 GYPSY7 5486bp 3547..3585 341..303 105 74.4 Minus

MIP29172.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:23 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20189280..20189675 1..396 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 16:20:11 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
CG42833-RA 1..264 26..289 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:53:31 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
CG42833-RA 1..264 26..289 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:25:58 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
CG42833-RA 1..264 26..289 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 16:20:10 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
CG42833-RA 1..264 26..289 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:53:31 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
CG42833-RA 1..395 1..394 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:25:58 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
CG42833-RA 1..395 1..394 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:23 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20200093..20200488 1..396 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:23 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20200093..20200488 1..396 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:23 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20200093..20200488 1..396 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:53:31 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20193193..20193588 1..396 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:27 Download gff for MIP29172.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20193193..20193588 1..396 99   Plus

MIP29172.hyp Sequence

Translation from 0 to 288

> MIP29172.hyp
VRDHRCIKMRASRGNGFSFYLIFSLLLICKLERILGDVSPADEKSIESNI
VTIWDRIASGVINYPWKTNIIEKESPETTKRRSVLWQRLTMATVL*

MIP29172.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG42833-PA 87 CG42833-PA 1..87 9..95 444 100 Plus

MIP29172.pep Sequence

Translation from 1 to 288

> MIP29172.pep
VRDHRCIKMRASRGNGFSFYLIFSLLLICKLERILGDVSPADEKSIESNI
VTIWDRIASGVINYPWKTNIIEKESPETTKRRSVLWQRLTMATVL*

MIP29172.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG42833-PA 87 CG42833-PA 1..87 9..95 444 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11527-PA 83 GI11527-PA 2..83 12..95 129 38.8 Plus