Clone Sequence Records
MIP29172.complete Sequence
421 bp assembled on 2011-03-01
GenBank Submission: BT126246.1
> MIP29172.complete
AGTTAGAGATCATCGCTGTATCAAAATGCGAGCATCCAGAGGAAATGGAT
TTTCATTTTACTTGATCTTTTCATTGCTGCTAATCTGCAAATTGGAAAGG
ATCTTAGGTGATGTAAGCCCGGCAGATGAGAAATCGATAGAGTCAAATAT
CGTCACAATTTGGGATCGAATTGCAAGCGGAGTTATAAACTATCCCTGGA
AAACTAATATCATTGAGAAGGAGAGCCCAGAAACTACTAAGAGGAGATCG
GTTCTATGGCAAAGACTAACGATGGCCACAGTTCTTTAATGGATACAAGT
ATTGCCTGATTGAAAATGTTAGTAATATGTCAACAAATTTTTATACAATT
CAGTGTGCTTGCTGTATTGCAAAATAAAGAGCCCCTTGTTTATTACAAAA
AAAAAAAAAAAAAAAAAAAAA
MIP29172.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:18:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 20189280..20189675 | 1..395 | 1930 | 99.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:18:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 20200093..20200488 | 1..395 | 1930 | 99.7 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 20193193..20193588 | 1..395 | 1940 | 99.7 | Plus |
Blast to na_te.dros performed 2019-03-16 22:18:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy7 | 5486 | gypsy7 GYPSY7 5486bp | 3547..3585 | 341..303 | 105 | 74.4 | Minus |
MIP29172.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:23 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 20189280..20189675 | 1..396 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 16:20:11 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42833-RA | 1..264 | 26..289 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:53:31 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42833-RA | 1..264 | 26..289 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:25:58 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42833-RA | 1..264 | 26..289 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 16:20:10 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42833-RA | 1..264 | 26..289 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:53:31 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42833-RA | 1..395 | 1..394 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:25:58 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42833-RA | 1..395 | 1..394 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:23 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20200093..20200488 | 1..396 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:23 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20200093..20200488 | 1..396 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:23 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20200093..20200488 | 1..396 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:53:31 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 20193193..20193588 | 1..396 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:27 Download gff for
MIP29172.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20193193..20193588 | 1..396 | 99 | | Plus |
MIP29172.hyp Sequence
Translation from 0 to 288
> MIP29172.hyp
VRDHRCIKMRASRGNGFSFYLIFSLLLICKLERILGDVSPADEKSIESNI
VTIWDRIASGVINYPWKTNIIEKESPETTKRRSVLWQRLTMATVL*
MIP29172.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42833-PA | 87 | CG42833-PA | 1..87 | 9..95 | 444 | 100 | Plus |
MIP29172.pep Sequence
Translation from 1 to 288
> MIP29172.pep
VRDHRCIKMRASRGNGFSFYLIFSLLLICKLERILGDVSPADEKSIESNI
VTIWDRIASGVINYPWKTNIIEKESPETTKRRSVLWQRLTMATVL*
MIP29172.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42833-PA | 87 | CG42833-PA | 1..87 | 9..95 | 444 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:58:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI11527-PA | 83 | GI11527-PA | 2..83 | 12..95 | 129 | 38.8 | Plus |