Clone Sequence Records
MIP29218.complete Sequence
403 bp assembled on 2011-03-01
GenBank Submission: BT126240.1
> MIP29218.complete
TTATCTGTCAGCATTGCCCTAAATTATTTAGAGATTTATTCCGAGTTTAT
ATCAAAATTTGTGGAATAAGTATGTCAGAACAACCGACACAACATAAATC
CGACGATCGCTTCACTATCCTGCAAACCTTATCGGATGTAGTGGACTCTG
GTCTCAGCAAGGAAGCCCTTAAAATCTGCATCGAACTGGTGGACAATGGT
GTCTGTGGTGGAGCACTAGCACATGTAATTCGAACCATTAGAGAGGAGAT
TCAAGATGATGAAGATAAGGAAAGTGATGATTCCGGAGAATCGGCTGCAT
CAACAGACTCAACTTTGTAGGAAATGAATATAAAATATATTTTTGTGTTT
ATATTTTGTGTTTGTTAAATTAAAAGTTCAACTTTCAAAAAAAAAAAAAA
AAA
MIP29218.complete Blast Records
Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:45:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 2388744..2389129 | 1..386 | 1915 | 99.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 2389265..2389650 | 1..386 | 1930 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:07:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 2389265..2389650 | 1..386 | 1930 | 100 | Plus |
Blast to na_te.dros performed 2019-03-17 01:45:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dbif\P-element_O | 2986 | Dbif\P-element_O P_O 2986bp Derived from X71634. | 2748..2813 | 383..323 | 128 | 72.7 | Minus |
Stalker | 7256 | Stalker STALKER 7256bp | 6590..6641 | 363..313 | 122 | 75.5 | Minus |
rover | 7318 | rover ROVER 7318bp | 4495..4564 | 362..291 | 121 | 65.3 | Minus |
gypsy11 | 4428 | gypsy11 GYPSY11 4428bp | 3641..3691 | 378..327 | 113 | 71.2 | Minus |
S-element | 1736 | S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). | 931..1004 | 365..293 | 106 | 62.2 | Minus |
Dana\Tom | 7060 | Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). | 4396..4434 | 363..325 | 105 | 74.4 | Minus |
TAHRE | 10463 | TAHRE OSV 10463bp | 7853..7935 | 363..279 | 104 | 61.2 | Minus |
Stalker4 | 7359 | Stalker4 STALKER4 7359bp | 6693..6749 | 368..313 | 103 | 69.5 | Minus |
MIP29218.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:46:02 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 2388744..2389129 | 1..386 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 10:32:30 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42787-RA | 1..249 | 72..320 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:51:53 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42787-RA | 1..249 | 72..320 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:11 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42787-RA | 1..249 | 72..320 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 10:32:30 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42787-RA | 1..249 | 72..320 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:51:53 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42787-RA | 1..386 | 1..386 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:11 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42787-RA | 1..386 | 1..386 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:02 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 2389265..2389650 | 1..386 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:02 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 2389265..2389650 | 1..386 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:02 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 2389265..2389650 | 1..386 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:51:53 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 2389265..2389650 | 1..386 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:04 Download gff for
MIP29218.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 2389265..2389650 | 1..386 | 100 | | Plus |
MIP29218.hyp Sequence
Translation from 2 to 319
> MIP29218.hyp
ICQHCPKLFRDLFRVYIKICGISMSEQPTQHKSDDRFTILQTLSDVVDSG
LSKEALKICIELVDNGVCGGALAHVIRTIREEIQDDEDKESDDSGESAAS
TDSTL*
MIP29218.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42787-PA | 82 | CG42787-PA | 1..82 | 24..105 | 411 | 100 | Plus |
MIP29218.pep Sequence
Translation from 2 to 319
> MIP29218.pep
ICQHCPKLFRDLFRVYIKICGISMSEQPTQHKSDDRFTILQTLSDVVDSG
LSKEALKICIELVDNGVCGGALAHVIRTIREEIQDDEDKESDDSGESAAS
TDSTL*
MIP29218.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:55:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24917-PA | 121 | GF24917-PA | 29..95 | 29..100 | 136 | 44.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42787-PA | 82 | CG42787-PA | 1..82 | 24..105 | 411 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:55:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14488-PA | 82 | GM14488-PA | 1..82 | 24..105 | 360 | 86.6 | Plus |