Clone MIP29218 Report

Search the DGRC for MIP29218

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:292
Well:18
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42787-RA
Protein status:MIP29218.pep: gold
Sequenced Size:403

Clone Sequence Records

MIP29218.complete Sequence

403 bp assembled on 2011-03-01

GenBank Submission: BT126240.1

> MIP29218.complete
TTATCTGTCAGCATTGCCCTAAATTATTTAGAGATTTATTCCGAGTTTAT
ATCAAAATTTGTGGAATAAGTATGTCAGAACAACCGACACAACATAAATC
CGACGATCGCTTCACTATCCTGCAAACCTTATCGGATGTAGTGGACTCTG
GTCTCAGCAAGGAAGCCCTTAAAATCTGCATCGAACTGGTGGACAATGGT
GTCTGTGGTGGAGCACTAGCACATGTAATTCGAACCATTAGAGAGGAGAT
TCAAGATGATGAAGATAAGGAAAGTGATGATTCCGGAGAATCGGCTGCAT
CAACAGACTCAACTTTGTAGGAAATGAATATAAAATATATTTTTGTGTTT
ATATTTTGTGTTTGTTAAATTAAAAGTTCAACTTTCAAAAAAAAAAAAAA
AAA

MIP29218.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2388744..2389129 1..386 1915 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2389265..2389650 1..386 1930 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2389265..2389650 1..386 1930 100 Plus
Blast to na_te.dros performed 2019-03-17 01:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2748..2813 383..323 128 72.7 Minus
Stalker 7256 Stalker STALKER 7256bp 6590..6641 363..313 122 75.5 Minus
rover 7318 rover ROVER 7318bp 4495..4564 362..291 121 65.3 Minus
gypsy11 4428 gypsy11 GYPSY11 4428bp 3641..3691 378..327 113 71.2 Minus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 931..1004 365..293 106 62.2 Minus
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 4396..4434 363..325 105 74.4 Minus
TAHRE 10463 TAHRE OSV 10463bp 7853..7935 363..279 104 61.2 Minus
Stalker4 7359 Stalker4 STALKER4 7359bp 6693..6749 368..313 103 69.5 Minus

MIP29218.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:46:02 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2388744..2389129 1..386 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 10:32:30 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
CG42787-RA 1..249 72..320 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:51:53 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
CG42787-RA 1..249 72..320 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:11 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
CG42787-RA 1..249 72..320 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 10:32:30 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
CG42787-RA 1..249 72..320 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:51:53 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
CG42787-RA 1..386 1..386 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:11 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
CG42787-RA 1..386 1..386 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:02 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2389265..2389650 1..386 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:02 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2389265..2389650 1..386 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:02 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2389265..2389650 1..386 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:51:53 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2389265..2389650 1..386 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:04 Download gff for MIP29218.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2389265..2389650 1..386 100   Plus

MIP29218.hyp Sequence

Translation from 2 to 319

> MIP29218.hyp
ICQHCPKLFRDLFRVYIKICGISMSEQPTQHKSDDRFTILQTLSDVVDSG
LSKEALKICIELVDNGVCGGALAHVIRTIREEIQDDEDKESDDSGESAAS
TDSTL*

MIP29218.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42787-PA 82 CG42787-PA 1..82 24..105 411 100 Plus

MIP29218.pep Sequence

Translation from 2 to 319

> MIP29218.pep
ICQHCPKLFRDLFRVYIKICGISMSEQPTQHKSDDRFTILQTLSDVVDSG
LSKEALKICIELVDNGVCGGALAHVIRTIREEIQDDEDKESDDSGESAAS
TDSTL*

MIP29218.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24917-PA 121 GF24917-PA 29..95 29..100 136 44.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42787-PA 82 CG42787-PA 1..82 24..105 411 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14488-PA 82 GM14488-PA 1..82 24..105 360 86.6 Plus