Clone MIP29220 Report

Search the DGRC for MIP29220

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:292
Well:20
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42814-RA
Protein status:MIP29220.pep: gold
Sequenced Size:814

Clone Sequence Records

MIP29220.complete Sequence

814 bp assembled on 2011-03-01

GenBank Submission: BT126241.1

> MIP29220.complete
TAAAAACCATCGAAATGCTTTTCAAAAACACAAAACATGTTAAGACTACT
GGGCAGTTTGGGTCGCTCCTGCTGCTCGTCAGCCAAATCGGGCTTCAAGA
TCCAGCCAAGTTGTATTTCAAAGATTTGGTTTGGTCCGATGCCCAAGGAT
TCGAATTGGATTAAGCCAGGTCGACTTCACTACATCGAAAACGATGTGGA
GAAACAGGTGGACATTATCAAAACCATAGATGGTGTGGTCGTGATTCTGT
ACAACAAAGCGAGGGAAAAACTAATCTTCGTGCGTCAATTTAGGGGAGCA
GTTTACCAGGGAATACATTCGGCTGGATCACCAGACATGTCCAAGGGAGA
AGCTGATCTGGAGCAGTTTCCTCCCGAAGTAGGAGTCACTTTGGAACTTT
GCGGTGGCGCCGTGGACAAGGACAAAAGCCTGGCGGAGATCGCCAAGGAG
GAAGTCCTCGAAGAGTGCGGTTACGAGGTGCCCACCGAATCCCTGCAGCA
TGTCTACGACTATAGGTCGGGTATTGGTACCTCAAGTAGTGCCATGTCTC
TGTTCTACTGCGAGGTGTGTGATGCTCAGAAGGTCTCGGCGGGCGGTGGC
ATTGGAGAAGAGCGAATCCAGGTGCTAGAAATGTCCTTGGAGGAGTCGAG
GCAGCTGGTCCAAACTGGGGCGACCACCAATGGTGGACCATCCTGTTTGC
TGGGTCTGCTTTGGTTCTTTCAGCACAAGGCACCCAAGGTTTTAGCTTAG
CATAGTAGGGTTAAACACTTTAAATATACTAATTAGCTAATATATTAAAA
AAAAAAAAAAAAAA

MIP29220.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23051597..23052392 796..1 3965 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27228671..27229468 798..1 3990 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26969502..26970299 798..1 3990 100 Minus
Blast to na_te.dros performed on 2019-03-17 01:46:31 has no hits.

MIP29220.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:47:36 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23051606..23052392 1..787 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 11:23:04 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
CG42814-RA 1..714 37..750 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:29 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
CG42814-RA 1..714 37..750 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:10:57 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
CG42814-RA 1..714 37..750 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 11:23:02 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
CG42814-RA 1..714 37..750 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:29 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
CG42814-RA 1..796 1..796 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:10:57 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
CG42814-RA 1..796 1..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:36 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27228673..27229468 1..796 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:36 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27228673..27229468 1..796 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:47:36 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27228673..27229468 1..796 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:29 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23054395..23055190 1..796 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:07 Download gff for MIP29220.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26969504..26970299 1..796 100   Minus

MIP29220.pep Sequence

Translation from 36 to 749

> MIP29220.pep
MLRLLGSLGRSCCSSAKSGFKIQPSCISKIWFGPMPKDSNWIKPGRLHYI
ENDVEKQVDIIKTIDGVVVILYNKAREKLIFVRQFRGAVYQGIHSAGSPD
MSKGEADLEQFPPEVGVTLELCGGAVDKDKSLAEIAKEEVLEECGYEVPT
ESLQHVYDYRSGIGTSSSAMSLFYCEVCDAQKVSAGGGIGEERIQVLEMS
LEESRQLVQTGATTNGGPSCLLGLLWFFQHKAPKVLA*

MIP29220.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22943-PA 406 GF22943-PA 1..191 35..225 693 67 Plus
Dana\GF22943-PA 406 GF22943-PA 196..401 27..234 642 52.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12132-PA 438 GG12132-PA 1..225 1..225 1104 91.6 Plus
Dere\GG12132-PA 438 GG12132-PA 230..434 27..233 653 55.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21295-PA 228 GH21295-PA 21..227 25..231 669 58.5 Plus
Dgri\GH21306-PA 211 GH21306-PA 4..209 27..234 640 53.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42814-PA 237 CG31063-PA 1..237 1..237 1236 100 Plus
CG42813-PA 212 CG31063-PA 4..208 27..233 641 54.6 Plus
CG42813-PB 212 CG42813-PB 4..208 27..233 641 54.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10493-PA 442 GI10493-PA 235..439 27..233 648 55.6 Plus
Dmoj\GI10493-PA 442 GI10493-PA 1..225 1..225 616 52 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23606-PA 1241 GL23606-PA 1034..1238 27..233 646 53.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26653-PA 211 GA26653-PA 4..208 27..233 637 53.6 Plus
Dpse\GA26652-PA 182 GA26652-PA 1..180 54..234 631 61.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10125-PA 404 GM10125-PA 1..191 35..225 987 97.9 Plus
Dsec\GM10125-PA 404 GM10125-PA 196..400 27..233 652 54.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18086-PA 438 GD18086-PA 1..225 1..225 1166 98.2 Plus
Dsim\GD18086-PA 438 GD18086-PA 230..434 27..233 655 55.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23174-PA 234 GJ23174-PA 1..233 1..231 680 54.1 Plus
Dvir\GJ23175-PA 211 GJ23175-PA 4..208 27..233 631 53.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11191-PA 406 GK11191-PA 199..403 27..233 602 51.2 Plus
Dwil\GK11191-PA 406 GK11191-PA 1..224 1..230 583 50.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10580-PA 404 GE10580-PA 1..191 35..225 916 90.1 Plus
Dyak\GE10580-PA 404 GE10580-PA 184..400 24..233 652 53 Plus

MIP29220.hyp Sequence

Translation from 36 to 749

> MIP29220.hyp
MLRLLGSLGRSCCSSAKSGFKIQPSCISKIWFGPMPKDSNWIKPGRLHYI
ENDVEKQVDIIKTIDGVVVILYNKAREKLIFVRQFRGAVYQGIHSAGSPD
MSKGEADLEQFPPEVGVTLELCGGAVDKDKSLAEIAKEEVLEECGYEVPT
ESLQHVYDYRSGIGTSSSAMSLFYCEVCDAQKVSAGGGIGEERIQVLEMS
LEESRQLVQTGATTNGGPSCLLGLLWFFQHKAPKVLA*

MIP29220.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG42814-PA 237 CG31063-PA 1..237 1..237 1236 100 Plus
CG42813-PA 212 CG31063-PA 4..208 27..233 641 54.6 Plus
CG42813-PB 212 CG42813-PB 4..208 27..233 641 54.6 Plus