Clone MIP29222 Report

Search the DGRC for MIP29222

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:292
Well:22
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42830-RA
Protein status:MIP29222.pep: gold
Sequenced Size:754

Clone Sequence Records

MIP29222.complete Sequence

754 bp assembled on 2011-03-01

GenBank Submission: BT126244.1

> MIP29222.complete
CAGTTTGCCTGTCGAATTGGAAGTGAACAGAACAAATCGAAAAAAAAATT
AATAGCCAAAATATTAACATGAGTCACATAACTCGAAAGCGTTTACTAAC
TTTGGATGAGGAATCTCAGCATATCAATTCGACAAAACGATGTGGGAGCA
ACTGCATCGAGAAGATGTTAACAAAATGGTCCCGCCAAAGTATTCCAGGC
GTCAATAGCATTTCGCGGAAGCGATCGTTTCCTTGGGAGGATAACTCGCC
TGATATATTTCCCGCAAAACATTCACGAAAGCATATCATAAAAAAGAAGT
CGAAAACAATTCACGAGCCAGAGGTCCCGATAGATTTTTTGATGGGACTG
CCAGTATTGCTTGATAGTGACTTTAGTGATTCGGAGGAATGTCGCCCAAA
ATCAGAGATTCATGTGGCCAAACCAGAAACTGAAGATAACCGAGATTTGT
TTACCTATCAGCAATTGAAATTAATGTGCTGCGAAATGATGAAACAATGC
GAAGATCGGGTAGTACTGGAATATGAAATAGCATTGACTCAAAAAATGGC
AGAGCAGTATGATACATTCATCAAGTTCAACCACGACCAATTGCAGCGAG
AATGTGAACATAGGGCTAGTTATTTGTCTTAGACAGTTTGTTGTATTATT
GTCTTATTAACTTGTTTCGAAAATTGTTTATGTGAGTTTAGCAAGAATAA
AAGAATATCTCTTCGCTTATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

MIP29222.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17810578..17811298 720..1 3525 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17811950..17812672 723..1 3615 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17811950..17812672 723..1 3615 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:15:14 has no hits.

MIP29222.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:16:03 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17810578..17811298 1..720 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 13:31:52 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42830-RA 1..564 69..632 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:57 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42830-RA 1..564 69..632 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:25:26 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42830-RA 1..564 69..632 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 13:31:51 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42830-RA 1..564 69..632 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:57 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42830-RA 1..720 1..720 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:25:26 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
CG42830-RA 1..720 1..720 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:03 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17811953..17812672 1..720 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:03 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17811953..17812672 1..720 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:03 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17811953..17812672 1..720 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:57 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17811953..17812672 1..720 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:20 Download gff for MIP29222.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17811953..17812672 1..720 100   Minus

MIP29222.hyp Sequence

Translation from 68 to 631

> MIP29222.hyp
MSHITRKRLLTLDEESQHINSTKRCGSNCIEKMLTKWSRQSIPGVNSISR
KRSFPWEDNSPDIFPAKHSRKHIIKKKSKTIHEPEVPIDFLMGLPVLLDS
DFSDSEECRPKSEIHVAKPETEDNRDLFTYQQLKLMCCEMMKQCEDRVVL
EYEIALTQKMAEQYDTFIKFNHDQLQRECEHRASYLS*

MIP29222.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG42830-PA 187 CG42830-PA 1..187 1..187 996 100 Plus
akirin-PF 201 CG8580-PF 1..201 1..187 169 29.1 Plus
akirin-PE 201 CG8580-PE 1..201 1..187 169 29.1 Plus
akirin-PD 201 CG8580-PD 1..201 1..187 169 29.1 Plus
akirin-PC 201 CG8580-PC 1..201 1..187 169 29.1 Plus

MIP29222.pep Sequence

Translation from 68 to 631

> MIP29222.pep
MSHITRKRLLTLDEESQHINSTKRCGSNCIEKMLTKWSRQSIPGVNSISR
KRSFPWEDNSPDIFPAKHSRKHIIKKKSKTIHEPEVPIDFLMGLPVLLDS
DFSDSEECRPKSEIHVAKPETEDNRDLFTYQQLKLMCCEMMKQCEDRVVL
EYEIALTQKMAEQYDTFIKFNHDQLQRECEHRASYLS*

MIP29222.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15088-PA 1884 GF15088-PA 1..147 45..178 211 40.8 Plus
Dana\GF10638-PA 207 GF10638-PA 147..207 127..187 167 50.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21727-PA 2091 GG21727-PA 1..178 1..178 610 68 Plus
Dere\GG14420-PA 203 GG14420-PA 143..203 127..187 170 50.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14876-PA 209 GH14876-PA 110..209 93..187 177 41 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG42830-PA 187 CG42830-PA 1..187 1..187 996 100 Plus
akirin-PF 201 CG8580-PF 1..201 1..187 169 29.1 Plus
akirin-PE 201 CG8580-PE 1..201 1..187 169 29.1 Plus
akirin-PD 201 CG8580-PD 1..201 1..187 169 29.1 Plus
akirin-PC 201 CG8580-PC 1..201 1..187 169 29.1 Plus
akirin-PB 201 CG8580-PB 1..201 1..187 169 29.1 Plus
akirin-PA 201 CG8580-PA 1..201 1..187 169 29.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12849-PA 206 GI12849-PA 146..206 127..187 172 52.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26352-PA 186 GL26352-PA 126..186 127..187 170 50.8 Plus
Dper\GL24042-PA 191 GL24042-PA 129..191 125..187 139 44.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21176-PA 199 GA21176-PA 139..199 127..187 170 50.8 Plus
Dpse\GA23138-PA 136 GA23138-PA 1..136 45..187 153 32.9 Plus
Dpse\GA20415-PA 1885 GA20415-PA 98..148 125..175 147 49 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17110-PA 2044 GM17110-PA 1..178 1..178 770 82 Plus
Dsec\GM14836-PA 201 GM14836-PA 109..201 97..187 170 41.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21851-PA 2044 GD21851-PA 1..178 1..178 771 82.6 Plus
Dsim\GD14010-PA 201 GD14010-PA 109..201 97..187 170 41.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12994-PA 201 GJ12994-PA 141..201 127..187 170 52.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17376-PA 202 GK17376-PA 108..202 97..187 172 42.3 Plus
Dwil\GK20615-PA 167 GK20615-PA 96..167 116..187 164 40.3 Plus
Dwil\GK20616-PA 240 GK20616-PA 169..240 116..187 163 40.3 Plus
Dwil\GK20617-PA 167 GK20617-PA 96..167 116..187 159 38.9 Plus
Dwil\GK20213-PA 141 GK20213-PA 72..141 118..187 157 42.9 Plus
Dwil\GK20213-PA 141 GK20213-PA 10..74 116..180 143 41.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13116-PA 1972 GE13116-PA 1..180 1..178 626 66.7 Plus
Dyak\GE21610-PA 203 GE21610-PA 143..203 127..187 170 50.8 Plus