BDGP Sequence Production Resources |
Search the DGRC for MIP29229
Library: | MIP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2008-10-08 |
Comments: | |
Original Plate Number: | 292 |
Well: | 29 |
Vector: | pOT2|pOTB7_DraIII |
Associated Gene/Transcript | CG34029-RA |
Protein status: | MIP29229.pep: gold |
Sequenced Size: | 477 |
477 bp assembled on 2011-03-01
GenBank Submission: BT126112.1
> MIP29229.complete AGATTTCTCCCAAGTGCTTTGATCATATAATTTTGCCTGATTTGTGGACA TGGAATCCCCGGACAACAGGCTGTACATGTGCACCGCGTGCTTTAAAAGG TTTCTTTGGAGCGAACTGTCGAGGAAGGAGCTCCGCTGCGCTCAGTGCCG TCTGTCAACCAAAATCTGTGTCATTTGCGATAAGAAGTTTGAGCCGCGCG AAATGTCGCAAGTTTACTGCAAGCAATGCAATTTCTACATCGAGAGACAT GCCGTAGTCAAGCCCCCTCCCTTGGGTGTACAAATCGGAAAACCAGCGGA GATGACCAGTGGGCCAGGTACGGAAGGATCTTCGATCACAGAGCGCTGGA AGGAGATTAAGGCCGCCGCTGGAATCGTGGATGACTTTGATTGAATCGAC ATGCGTTTTATTAAAATTGATGTATCATCTTATGAAGAAAGATAATTGCT ATAAGAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 17857125..17857545 | 455..35 | 2045 | 99 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 21970763..21971187 | 459..35 | 2110 | 99.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
S2 | 1735 | S2 S2 1735bp | 1628..1689 | 438..382 | 109 | 69.4 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 17857125..17857544 | 36..455 | 99 | <- | Minus |
chr2R | 17857604..17857638 | 1..35 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34029-RA | 1..345 | 50..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34029-RA | 1..345 | 50..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34029-RA | 1..345 | 50..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34029-RA | 2..422 | 35..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34029-RA | 1..455 | 1..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34029-RA | 6..460 | 1..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21970767..21971186 | 36..455 | 100 | <- | Minus |
2R | 21971246..21971280 | 1..35 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21970767..21971186 | 36..455 | 100 | <- | Minus |
2R | 21971246..21971280 | 1..35 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21970767..21971186 | 36..455 | 100 | <- | Minus |
2R | 21971246..21971280 | 1..35 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 17858272..17858691 | 36..455 | 100 | <- | Minus |
arm_2R | 17858751..17858785 | 1..35 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21971966..21972385 | 36..455 | 100 | <- | Minus |
2R | 21972445..21972479 | 1..35 | 100 | Minus |
Translation from 49 to 393
> MIP29229.pep MESPDNRLYMCTACFKRFLWSELSRKELRCAQCRLSTKICVICDKKFEPR EMSQVYCKQCNFYIERHAVVKPPPLGVQIGKPAEMTSGPGTEGSSITERW KEIKAAAGIVDDFD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11618-PA | 114 | GF11618-PA | 3..108 | 1..114 | 284 | 48.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20733-PA | 114 | GG20733-PA | 1..110 | 1..112 | 370 | 61.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20766-PA | 125 | GH20766-PA | 1..122 | 1..113 | 248 | 40.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34029-PA | 114 | CG34029-PA | 1..114 | 1..114 | 621 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20847-PA | 124 | GI20847-PA | 1..119 | 1..112 | 247 | 42 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17504-PA | 198 | GL17504-PA | 9..82 | 1..74 | 225 | 51.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24181-PA | 131 | GA24181-PA | 9..128 | 1..114 | 233 | 43.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15677-PA | 114 | GM15677-PA | 1..114 | 1..114 | 578 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25157-PA | 63 | GD25157-PA | 1..63 | 52..114 | 311 | 92.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20584-PA | 117 | GJ20584-PA | 1..114 | 1..113 | 266 | 43.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15639-PA | 121 | GK15639-PA | 1..117 | 1..113 | 304 | 48.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13665-PA | 114 | GE13665-PA | 1..110 | 1..112 | 404 | 71.4 | Plus |
Translation from 49 to 393
> MIP29229.hyp MESPDNRLYMCTACFKRFLWSELSRKELRCAQCRLSTKICVICDKKFEPR EMSQVYCKQCNFYIERHAVVKPPPLGVQIGKPAEMTSGPGTEGSSITERW KEIKAAAGIVDDFD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34029-PA | 114 | CG34029-PA | 1..114 | 1..114 | 621 | 100 | Plus |