Clone MIP29229 Report

Search the DGRC for MIP29229

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:292
Well:29
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34029-RA
Protein status:MIP29229.pep: gold
Sequenced Size:477

Clone Sequence Records

MIP29229.complete Sequence

477 bp assembled on 2011-03-01

GenBank Submission: BT126112.1

> MIP29229.complete
AGATTTCTCCCAAGTGCTTTGATCATATAATTTTGCCTGATTTGTGGACA
TGGAATCCCCGGACAACAGGCTGTACATGTGCACCGCGTGCTTTAAAAGG
TTTCTTTGGAGCGAACTGTCGAGGAAGGAGCTCCGCTGCGCTCAGTGCCG
TCTGTCAACCAAAATCTGTGTCATTTGCGATAAGAAGTTTGAGCCGCGCG
AAATGTCGCAAGTTTACTGCAAGCAATGCAATTTCTACATCGAGAGACAT
GCCGTAGTCAAGCCCCCTCCCTTGGGTGTACAAATCGGAAAACCAGCGGA
GATGACCAGTGGGCCAGGTACGGAAGGATCTTCGATCACAGAGCGCTGGA
AGGAGATTAAGGCCGCCGCTGGAATCGTGGATGACTTTGATTGAATCGAC
ATGCGTTTTATTAAAATTGATGTATCATCTTATGAAGAAAGATAATTGCT
ATAAGAAAAAAAAAAAAAAAAAAAAAA

MIP29229.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17857125..17857545 455..35 2045 99 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21970763..21971187 459..35 2110 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21971962..21972386 459..35 2110 99.7 Minus
2R 25260384 2R 21972445..21972479 35..1 175 100 Minus
Blast to na_te.dros performed 2019-03-16 22:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
S2 1735 S2 S2 1735bp 1628..1689 438..382 109 69.4 Minus

MIP29229.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:15:56 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17857125..17857544 36..455 99 <- Minus
chr2R 17857604..17857638 1..35 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-01 11:51:08 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34029-RA 1..345 50..394 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:52:43 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34029-RA 1..345 50..394 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:25:15 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34029-RA 1..345 50..394 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-01 11:51:08 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34029-RA 2..422 35..455 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:52:43 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34029-RA 1..455 1..455 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:25:15 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
CG34029-RA 6..460 1..455 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:56 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21970767..21971186 36..455 100 <- Minus
2R 21971246..21971280 1..35 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:56 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21970767..21971186 36..455 100 <- Minus
2R 21971246..21971280 1..35 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:56 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21970767..21971186 36..455 100 <- Minus
2R 21971246..21971280 1..35 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:52:43 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17858272..17858691 36..455 100 <- Minus
arm_2R 17858751..17858785 1..35 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:15 Download gff for MIP29229.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21971966..21972385 36..455 100 <- Minus
2R 21972445..21972479 1..35 100   Minus

MIP29229.pep Sequence

Translation from 49 to 393

> MIP29229.pep
MESPDNRLYMCTACFKRFLWSELSRKELRCAQCRLSTKICVICDKKFEPR
EMSQVYCKQCNFYIERHAVVKPPPLGVQIGKPAEMTSGPGTEGSSITERW
KEIKAAAGIVDDFD*

MIP29229.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11618-PA 114 GF11618-PA 3..108 1..114 284 48.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20733-PA 114 GG20733-PA 1..110 1..112 370 61.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20766-PA 125 GH20766-PA 1..122 1..113 248 40.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG34029-PA 114 CG34029-PA 1..114 1..114 621 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20847-PA 124 GI20847-PA 1..119 1..112 247 42 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17504-PA 198 GL17504-PA 9..82 1..74 225 51.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24181-PA 131 GA24181-PA 9..128 1..114 233 43.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15677-PA 114 GM15677-PA 1..114 1..114 578 93.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25157-PA 63 GD25157-PA 1..63 52..114 311 92.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20584-PA 117 GJ20584-PA 1..114 1..113 266 43.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15639-PA 121 GK15639-PA 1..117 1..113 304 48.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13665-PA 114 GE13665-PA 1..110 1..112 404 71.4 Plus

MIP29229.hyp Sequence

Translation from 49 to 393

> MIP29229.hyp
MESPDNRLYMCTACFKRFLWSELSRKELRCAQCRLSTKICVICDKKFEPR
EMSQVYCKQCNFYIERHAVVKPPPLGVQIGKPAEMTSGPGTEGSSITERW
KEIKAAAGIVDDFD*

MIP29229.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG34029-PA 114 CG34029-PA 1..114 1..114 621 100 Plus